GithubHelp home page GithubHelp logo

Comments (4)

kdyrhage avatar kdyrhage commented on August 26, 2024

It works fine for me on v0.3.2 and master, after copying the contents to a file. Could you upload the actual problematic file somewhere?

from genomicannotations.jl.

adityanprasad avatar adityanprasad commented on August 26, 2024

Thanks for such a quick response. Sorry, I updated my version of GenomicAnnotations and it reads the file now. However, there's still a problem when trying to access genes. I think it's some issue with printing to stdout. For instance,

plasmid = readgbk("file.gb")[1]
plasmid.genes

will run indefinitely and not return anything, but

for gene in pAC03.genes
    @show "$(plasmid.name)_$(gene.locus_tag)"
end

will return almost immediately. Similarly,

@genes(plasmid, ismissing(:gene))

will get stuck but

@genes(plasmid, ismissing(:gene)) |> length

works. Hopefully, you're able to replicate this behavior.

EDIT:

for gene in pAC03.genes
    @show gene
end

gets stuck at

gene =      primer          4277..4298
                     /label="oLAC18"
                     /note="sequence: AGGAcaagagacaggatactag"
                     /ApEinfo_revcolor="#faac61"
                     /ApEinfo_fwdcolor="#faac61"

Is there something wrong with the format of the .gb file at or after this primer annotation?

from genomicannotations.jl.

kdyrhage avatar kdyrhage commented on August 26, 2024
                     /note="product: photostable monomeric orange derivative of DsRed fluorescent protein (Shaner et al., 2008) note: mammalian codon-optimized translation: MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGFQTAKLKVTKGGPLPFAWDILSPHFTYGSKAYVKHPADIPDYFKLSFPEGFKWERVMNYEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGKIKMRLKLKDGGHYTSEVKTTYKAKKPVQLPGAYIVDIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK"

This long line was causing problems with the printing. I've included a fix in v0.3.3 and registered it, until it is merged you can use the master branch. Thanks for the help!

from genomicannotations.jl.

adityanprasad avatar adityanprasad commented on August 26, 2024

Thanks for such quick responses. Really appreciate your work in this package

from genomicannotations.jl.

Related Issues (9)

Recommend Projects

  • React photo React

    A declarative, efficient, and flexible JavaScript library for building user interfaces.

  • Vue.js photo Vue.js

    🖖 Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.

  • Typescript photo Typescript

    TypeScript is a superset of JavaScript that compiles to clean JavaScript output.

  • TensorFlow photo TensorFlow

    An Open Source Machine Learning Framework for Everyone

  • Django photo Django

    The Web framework for perfectionists with deadlines.

  • D3 photo D3

    Bring data to life with SVG, Canvas and HTML. 📊📈🎉

Recommend Topics

  • javascript

    JavaScript (JS) is a lightweight interpreted programming language with first-class functions.

  • web

    Some thing interesting about web. New door for the world.

  • server

    A server is a program made to process requests and deliver data to clients.

  • Machine learning

    Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.

  • Game

    Some thing interesting about game, make everyone happy.

Recommend Org

  • Facebook photo Facebook

    We are working to build community through open source technology. NB: members must have two-factor auth.

  • Microsoft photo Microsoft

    Open source projects and samples from Microsoft.

  • Google photo Google

    Google ❤️ Open Source for everyone.

  • D3 photo D3

    Data-Driven Documents codes.