JacobHayes/msgvault

Archive a lifetime of email and chat. Offline search, analytics, and AI query over your full message history. Powered by SQLite and DuckDB

★ 0Forks 0GitHub ↗Compare

Project website ↗

README

msgvault logo

msgvault

Go 1.26+ License: MIT Docs Discord

Documentation · Setup Guide · Interactive TUI

Alpha software. APIs, storage format, and CLI flags may change without notice. Back up your data.

Archive a lifetime of email, messages, meetings. Analytics and search in milliseconds, entirely offline.

Why msgvault?

Your messages are yours. Decades of correspondence, attachments, and history shouldn't be locked behind a web interface or an API. By default, msgvault downloads a complete local copy and then everything runs offline. Search, analytics, and the MCP server all work against your msgvault archive with no mailbox network access required. If you configure a remote deployment, the archive lives on your own server rather than a hosted msgvault service.

Currently supports Gmail, Google Calendar, Microsoft Teams, Discord, Slack, Granola, Circleback, Beeper Desktop, and IMAP sync, plus offline imports from MBOX exports, Apple Mail (.emlx) directories, PST archives, and common chat/text export formats.

Features

  • Full Gmail backup: raw MIME, attachments, labels, and metadata
  • Google Calendar sync: archive events, organizers, and attendees; searchable alongside email
  • Microsoft Teams sync: archive delegated Graph chats, channels, replies, and inline media with message_type = teams
  • Discord sync: archive guild channels, threads, forum posts, and attachments through a read-only bot with message_type = discord
  • Slack sync: archive joined channels, group DMs, direct messages, threads, reactions, and files with message_type = slack
  • Meeting notes: sync Granola and Circleback notes and transcripts, then browse them in the TUI
  • Beeper Desktop sync: archive chats and media from every network connected to Beeper, including iMessage, through its local API
  • IMAP sync: archive mail from any standard IMAP server
  • Incremental backup snapshots: verifiable msgvault backup repositories for the SQLite archive and attachments
  • MBOX / Apple Mail / PST import: import email from local export formats
  • First-party web UI: dense, keyboard-driven search, grouping, people/domain, file, source, and deletion workspaces served directly by the daemon
  • Interactive TUI: drill-down analytics over your entire message history, powered by DuckDB over Parquet — connects to a remote msgvault serve instance or runs locally
  • Full-text search: FTS5 with Gmail-like query syntax (from:, has:attachment, date ranges)
  • MCP server: access your full archive at the speed of thought in Claude Desktop and other MCP-capable AI agents
  • DuckDB analytics: millisecond aggregate queries across hundreds of thousands of messages in the TUI, CLI, and MCP server
  • Incremental sync: History API picks up only new and changed messages
  • Multi-account: archive several Gmail and IMAP accounts in a single database
  • Resumable: interrupted syncs resume from the last checkpoint
  • Content-addressed attachments: deduplicated by SHA-256
  • Packed attachment storage: sealed immutable packs reduce filesystem overhead, with pack, repack, and unpack maintenance commands
  • Agent skills: install bundled search, attachment, and analytics workflows for Claude Code and Codex

Installation

macOS / Linux:

curl -fsSL https://msgvault.io/install.sh | bash

macOS via Homebrew

brew install msgvault

Windows (PowerShell):

powershell -ExecutionPolicy ByPass -c "irm https://msgvault.io/install.ps1 | iex"

The installer detects your OS and architecture, downloads the latest release from GitHub Releases, verifies the SHA-256 checksum, and installs the binary. You can review the script (bash, PowerShell) before running, or download a release binary directly from GitHub.

To build from source instead (requires Go 1.26+, Bun 1.3.14+, and a C/C++ compiler for CGO and to statically link DuckDB):

git clone https://github.com/kenn-io/msgvault.git
cd msgvault
make install

Conda-Forge:

You can install msgvault from conda-forge using Pixi or Conda:

pixi global install msgvault
conda install -c conda-forge msgvault

Quick Start

Prerequisites: You need a Google Cloud OAuth credential before adding an account. Follow the OAuth Setup Guide to create one (~5 minutes).

msgvault init-db
msgvault add-account [email protected]          # opens browser for OAuth
msgvault sync-full [email protected] --limit 100
msgvault serve

Open the API server URL printed by msgvault serve. The same release binary serves the complete browser application; Node, Bun, and a separate asset directory are not needed at runtime. See the Web UI guide for search modes, keyboard controls, and secure remote access. The TUI remains available with msgvault tui.

Commands

Command Description
init-db Create the database
add-account EMAIL Authorize a Gmail account (use --headless for servers) or add an IMAP account
sync-full EMAIL Full sync (--limit N, --after/--before for date ranges)
sync EMAIL Sync only new/changed messages
add-calendar EMAIL Authorize read-only Google Calendar access and register calendars
sync-calendar NAME|EMAIL Sync Google Calendar events (full first run, then incremental)
add-teams EMAIL Authorize delegated Microsoft Graph access for Teams
sync-teams EMAIL Sync Microsoft Teams chats and channels
add-discord / sync-discord Register a read-only bot and sync Discord guild channels and threads
add-slack / sync-slack Register and archive a Slack workspace, including threads and media
export-messages Stream a bounded, provider-neutral archive window as versioned JSONL
export-discord Temporary compatibility export for bounded Discord history
backfill-discord-media Retry incomplete Discord attachment downloads
add-granola / sync-granola Register and sync Granola meeting notes and transcripts
add-circleback / sync-circleback Authorize and sync Circleback meetings, notes, and transcripts
add-beeper / sync-beeper Register and sync Beeper Desktop chats and media
backup Initialize, create, list, verify, and restore backup snapshots
pack-attachments Migrate all eligible loose attachment files into immutable packs
repack-attachments Reclaim dead space from sparse attachment packs
unpack-attachments Restore packed attachments to loose files for downgrade or recovery
tui Launch the interactive TUI (--account to filter, --local to force the local daemon)
search QUERY Search messages (--account and --message-type to filter, --json for machine output)
show-message ID View full message details (--json for machine output)
mcp Start the MCP server for AI assistant integration
skills install Install bundled agent skills for search, attachments, and analytics
identity Manage and discover source-scoped identifiers that mean “me”
person Manage durable person profiles and typed attributes
attribute-definition Manage portable metadata-defined profile fields
daemon Manage the local background daemon (start, status, stop, restart)
serve Run the Web UI, API, and scheduler in the foreground
stats Show archive statistics
list-accounts List synced email accounts
verify EMAIL Verify archive integrity against Gmail
export-eml Export a message as .eml
import-mbox Import email from an MBOX export or .zip of MBOX files
import-emlx Import email from an Apple Mail directory tree
build-cache Rebuild the Parquet analytics cache
update Update msgvault to the latest version
setup Interactive first-run configuration wizard
repair-encoding Fix UTF-8 encoding issues
repair-dates Report or repair missing and implausible email sent dates
list-senders / list-domains / list-labels Explore metadata

See the CLI Reference for full details and People, Profiles, and Source Identities for the identity and profile model.

Vector Search

msgvault can search your archive semantically using vector embeddings in addition to the default FTS5 keyword search. Point it at a self-hosted OpenAI-compatible embedding endpoint (Ollama, llama.cpp, LM Studio) and three surfaces accept either pure semantic search or BM25+vector fused via Reciprocal Rank Fusion:

  • CLI: msgvault search "..." --mode vector or --mode hybrid
  • HTTP: GET /api/v1/search?q=...&mode=vector or mode=hybrid
  • MCP: semantic_search_messages with mode set to vector or hybrid

A separate MCP tool, find_similar_messages, returns nearest neighbors for a seed message. See the Vector Search guide for setup, backfill, and troubleshooting.

Archive writes are daemon-owned. CLI writer commands such as msgvault sync-full, msgvault embeddings build, msgvault repair-dates --apply, and msgvault rebuild-fts send their work to the configured remote server or local background daemon. The daemon serializes archive mutations and streams progress back to your terminal, so normal CLI ergonomics stay the same without opening a second SQLite writer process.

Large archives can scope an embedding generation with [vector.embed.scope] message_types = ["sms", "mms"]. Scoped vector and hybrid searches must include a matching message_type filter so a partial index is never used as if it covered the whole archive.

Importing from MBOX or Apple Mail

Import email from providers that offer MBOX exports or from a local Apple Mail data directory:

msgvault init-db
msgvault import-mbox [email protected] /path/to/export.mbox
msgvault import-mbox [email protected] /path/to/export.zip   # zip of MBOX files
msgvault import-emlx                                        # auto-discover Apple Mail accounts
msgvault import-emlx [email protected] ~/Library/Mail/V10     # explicit path

Import SMS Backup & Restore for Android (synctech-sms)

Msgvault can import XML backups produced by SMS Backup & Restore by SyncTech Pty Ltd. The Android app is listed in Google Play as SMS Backup & Restore and uses package com.riteshsahu.SMSBackupRestore; the Pro app uses com.riteshsahu.SMSBackupRestorePro.

Install the Android app on the phone that owns the messages, then configure a scheduled backup:

  1. Open SMS Backup & Restore.
  2. Choose Set Up A Backup.
  3. Include Messages, MMS media, and Call logs.
  4. Choose Google Drive as the backup location.
  5. Use a dedicated Drive folder for Msgvault imports.
  6. Choose Incremental backups for daily operation. Full and archive backups also import correctly, but incremental backups keep each daily upload smaller.
  7. Schedule the Android backup for a quiet time such as 4:00 AM.
  8. Leave backup encryption off. Msgvault does not import encrypted Pro backups.

Configure Msgvault to read that Drive folder:

msgvault add-synctech-sms-drive pixel \
  --owner-phone +15550000001 \
  --folder-id 1exampleDriveFolderId \
  --google-account [email protected] \
  --schedule "30 4 * * *"

The folder ID is the final path segment in a Google Drive folder URL. For example, in https://drive.google.com/drive/folders/1exampleDriveFolderId, the folder ID is 1exampleDriveFolderId.

Run the source immediately:

msgvault sync-synctech-sms pixel

You can also import local files, folders, or unencrypted ZIP backups:

msgvault import-synctech-sms --owner-phone +15550000001 ~/Downloads/sms-backup.xml
msgvault import-synctech-sms --owner-phone +15550000001 ~/Downloads/sms-backups/
msgvault import-synctech-sms --owner-phone +15550000001 ~/Downloads/sms-backup.zip

SMS and MMS messages appear in text-message search. Call logs are imported as searchable call records with message_type = synctech_sms_call, so missed and outgoing calls do not mix into normal text threads.

Google Calendar

Archive your calendars alongside email. Events become searchable (full-text and, when vector search is enabled, semantic) and join the same contact graph as your email, so organizers and attendees dedupe with the people you email.

# Authorize read-only Calendar access and register your calendars.
# If the account already has Gmail access, the consent screen asks for
# Gmail + Calendar together — keep BOTH checked so Gmail access is kept.
msgvault add-calendar [email protected]

# First run does a full sync; later runs are incremental.
msgvault sync-calendar [email protected]
msgvault sync-calendar [email protected] --full          # force a full re-sync
msgvault sync-calendar [email protected] --all-calendars # include subscribed/holiday calendars

# Find events
msgvault search "standup" --message-type calendar_event

By default only calendars you own or can write to are synced (add --all-calendars for subscribed and holiday calendars). Calendar sync is read-only and never modifies your Google Calendar. Cancelled events are kept (marked cancelled), not deleted, so your archive preserves that a meeting once existed. The Calendar API must be enabled on your Google Cloud OAuth project.

Msgvault stores Google OAuth refresh tokens under the Msgvault home directory with file permissions restricted to the current user. Tokens and client secrets are not written into config.toml, logs, README examples, or exported fixtures.

Microsoft Teams

Archive Microsoft Teams chats and channels through delegated Microsoft Graph sync. Teams uses the [microsoft] OAuth app config but stores a separate teams_<email>.json token from Outlook/IMAP OAuth.

msgvault add-teams [email protected]
msgvault sync-teams [email protected]
msgvault search "incident review" --message-type teams

See the Microsoft Teams guide for Graph permissions, scheduling, channel sync behavior, and inline media backfill.

Discord

Archive guild text and announcement channels, threads, forum posts, and attachments through a dedicated read-only bot:

msgvault add-discord --guild 123456789012345678
msgvault sync-discord 123456789012345678
msgvault export-messages \
  --start 2026-07-20T00:00:00Z --end 2026-07-27T00:00:00Z \
  --message-type discord --source discord:123456789012345678
msgvault search "incident review" --message-type discord

See the Discord guide for bot permissions, credential bindings, channel filters, scheduling, consistency limits, and media backfill.

Beeper

Archive every chat network bridged through Beeper Desktop (WhatsApp, Signal, Telegram, iMessage, Facebook Messenger, Instagram, Android SMS, Google Messages, Google Chat, Google Voice, GroupMe, IRC, LINE, LinkedIn, Matrix, Reddit, Tumblr, Twilio, X, Slack, and Discord) via its local read-only API — each connected network account becomes its own msgvault source:

msgvault add-beeper
msgvault sync-beeper                # first run backfills, later runs are incremental
msgvault backfill-beeper-media      # retry pending attachment downloads
msgvault search "incident review" --message-type beeper

See the Beeper guide for token setup, per-network sources, what gets archived, scheduling, and media backfill.

Backup Snapshots

Create an append-only backup repository, take incremental snapshots, and verify or restore them later:

msgvault backup init --repo ~/Backups/msgvault
msgvault backup create --repo ~/Backups/msgvault
msgvault backup verify --all --quick --repo ~/Backups/msgvault
msgvault backup restore --target ~/msgvault-restored --repo ~/Backups/msgvault

Set repo under [backup] in config.toml to omit --repo from every command after init.

See the Backup guide for repository format, secret-handling flags, restore verification, and operating recommendations.

Packed Attachment Storage

Msgvault stores attachment bytes in sealed content-addressed packs to reduce file-count overhead, especially on Windows and NAS filesystems. Existing loose vaults remain readable and migrate gradually after successful ingest runs and during daily maintenance; no startup migration is required. Run the following once to migrate the complete eligible backlog immediately:

msgvault pack-attachments

Reads, exports, MCP, and backups work transparently with loose, packed, or mixed storage. repack-attachments reclaims dead pack space and also runs automatically as bounded maintenance. Backup restore installs compatible packs directly by default and leaves only incompatible or oversized blobs loose; use backup restore --loose-attachments when an all-loose recovery layout is preferred.

unpack-attachments is the downgrade escape hatch. It requires exclusive local access because it deletes production pack files, so stop the local daemon first:

msgvault daemon stop
msgvault unpack-attachments

Configuration

All data lives in ~/.msgvault/ by default (override with MSGVAULT_HOME).

# ~/.msgvault/config.toml
[oauth]
client_secrets = "/path/to/client_secret.json"

[sync]
rate_limit_qps = 5

See the Configuration Guide for all options.

Multiple OAuth Apps (Google Workspace)

Some Google Workspace organizations require OAuth apps within their org. To use multiple OAuth apps, add named apps to config.toml:

[oauth]
client_secrets = "/path/to/default_secret.json"   # for personal Gmail

[oauth.apps.acme]
client_secrets = "/path/to/acme_workspace_secret.json"

Then specify the app when adding accounts:

msgvault add-account [email protected] --oauth-app acme
msgvault add-account [email protected]              # uses default

To switch an existing account to a different OAuth app:

msgvault add-account [email protected] --oauth-app acme   # re-authorizes

Google Service Accounts

Workspace admins can use a Google service account with domain-wide delegation instead of per-user OAuth tokens:

[oauth.apps.acme]
service_account_key = "/secure/path/service-account.json"

In Google Admin Console, authorize the service account client for https://www.googleapis.com/auth/gmail.readonly and https://www.googleapis.com/auth/gmail.modify. If you will archive Google Calendar, also authorize https://www.googleapis.com/auth/calendar.readonly. If you will run delete-staged with permanent deletion, also authorize https://mail.google.com/. Keep the key file owner-only, for example chmod 600 /secure/path/service-account.json.

msgvault add-account [email protected] --oauth-app acme
msgvault sync-full [email protected]

MCP Server

msgvault includes an MCP server that lets AI assistants search, analyze, and read your archived messages. Connect it to Claude Desktop or any MCP-capable agent and query your full message history conversationally. See the MCP documentation for setup instructions.

Daemon Mode (Local/Remote)

Run msgvault as a foreground server for scheduled syncs and remote access:

msgvault serve

For local CLI use, msgvault can also manage a background daemon:

msgvault daemon start
msgvault daemon status
msgvault daemon stop
msgvault daemon restart

Archive-access CLI commands use the HTTP API by default. If [remote].url is configured, the CLI talks to that remote server. Otherwise, it discovers or starts the local background daemon instead of opening the SQLite database itself. This keeps local and remote CLI behavior aligned and avoids repeated startup cost on large archives. Use --local to force the local daemon when a remote server is configured.

The server exposes the first-party analytical web UI at / and its generated OpenAPI document at /openapi.json.

Configure scheduled syncs in config.toml:

[[accounts]]
email = "[email protected]"
schedule = "0 2 * * *"   # 2am daily (cron)
enabled = true

[[gcal]]                  # scheduled Google Calendar sync
email = "[email protected]"
schedule = "0 */6 * * *" # every 6 hours
enabled = true

[server]
api_port = 8080
bind_addr = "0.0.0.0"
api_key = "your-secret-key"
daemon_idle_timeout = "20m" # background daemon idle timeout; "0s" disables

daemon_idle_timeout applies to lifecycle-managed background daemons started by msgvault daemon start or auto-started by a CLI command. A foreground msgvault serve keeps running until you stop it. See the Web UI & API Server reference or /openapi.json on a running server for the HTTP API.

Documentation

Community

Join the msgvault Discord to ask questions, share feedback, report issues, and connect with other users.

Development

git clone https://github.com/kenn-io/msgvault.git
cd msgvault
make install-hooks  # install pre-commit hook (requires prek)
make test           # run tests
make lint           # run linter (auto-fix)
make install        # build and install

Pre-commit hooks are managed by prek (brew install prek).

License

MIT. See LICENSE for details.

Contributors

wesmsalmonumbrelladependabot[bot]danshapirohughdbrownjesserobbinscpcloudmariusvniekerksweenzorrobelkinwebgressendolithhansn74etbyrdmattfnjtYourEconProfEconoBenbjabesm-j-rCygnusfearsocksycdelalamadavidggphyfranklintrafmasijasonkuhrtobraLazare-42MSch

Issues