SteVwonder/cue

The home of the CUE language! Validate and define text-based and dynamic configuration

★ 0Forks 0GitHub ↗Compare

Project website ↗

README

Go Reference Github GolangCI Go 1.20+ platforms

The CUE Data Constraint Language

Configure, Unify, Execute

CUE is an open source data constraint language which aims to simplify tasks involving defining and using data.

It is a superset of JSON, allowing users familiar with JSON to get started quickly.

What is it for?

You can use CUE to

  • define a detailed validation schema for your data (manually or automatically from data)
  • reduce boilerplate in your data (manually or automatically from schema)
  • extract a schema from code
  • generate type definitions and validation code
  • merge JSON in a principled way
  • define and run declarative scripts

How?

CUE merges the notion of schema and data. The same CUE definition can simultaneously be used for validating data and act as a template to reduce boilerplate. Schema definition is enriched with fine-grained value definitions and default values. At the same time, data can be simplified by removing values implied by such detailed definitions. The merging of these two concepts enables many tasks to be handled in a principled way.

Constraints provide a simple and well-defined, yet powerful, alternative to inheritance, a common source of complexity with configuration languages.

CUE Scripting

The CUE scripting layer defines declarative scripting, expressed in CUE, on top of data. This solves three problems: working around the closedness of CUE definitions (we say CUE is hermetic), providing an easy way to share common scripts and workflows for using data, and giving CUE the knowledge of how data is used to optimize validation.

There are many tools that interpret data or use a specialized language for a specific domain (Kustomize, Ksonnet). This solves dealing with data on one level, but the problem it solves may repeat itself at a higher level when integrating other systems in a workflow. CUE scripting is generic and allows users to define any workflow.

Tooling

CUE is designed for automation. Some aspects of this are:

  • convert existing YAML and JSON
  • automatically simplify configurations
  • rich APIs designed for automated tooling
  • formatter
  • arbitrary-precision arithmetic
  • generate CUE templates from source code
  • generate source code from CUE definitions (TODO)

Download and Install

Release builds

Download the latest release from GitHub.

Install using Homebrew

Using Homebrew, you can install using the CUE Homebrew tap:

brew install cue-lang/tap/cue

Install from Source

To install the cue command line tool, run:

go install cuelang.org/go/cmd/cue@latest

For more details, see Installing CUE.

Learning CUE

The fastest way to learn the basics is to follow the tutorial on basic language constructs.

A more elaborate tutorial demonstrating how to convert and restructure an existing set of Kubernetes configurations is available in written form.

References

Contributing

To contribute, please read the Contribution Guide.

Code of Conduct

Guidelines for participating in CUE community spaces and a reporting process for handling issues can be found in the Code of Conduct.

Contact

You can get in touch with the cuelang community in the following ways:


Unless otherwise noted, the CUE source files are distributed under the Apache 2.0 license found in the LICENSE file.

This is not an officially supported Google product.

Contributors

mpvlmyitcvmvdanrogpeppezcheeeonpataponjbaadieujlongtinechai20104adnoelmcloughlinbozarotklauserantongsatotakeyujunzverdvermslewiskellypalmamartinextemporalgenomejpluscplusmstromsvagjuniorzhrvolapeterpatflynnobowersaalexandearcristalolegmohammed90

Issues