Yigtwxx/OracleX

Open-source financial intelligence terminal for equities, Borsa İstanbul and digital assets. Real-time market data, LLM news analysis and a ChromaDB vector memory on a provider-agnostic reasoning layer — local via Ollama or a dozen cloud providers. Next.js 15 and FastAPI.

★ 2Forks 3PythonGitHub ↗Compare
aiai-financechromadbcryptocurrencyfastapifinancial-analysisllmmarket-datanextjsollamapythonragsentiment-analysisstockssupabasetradingtradingviewtypescriptvector-databasewebsocket

README

Oracle-X

Oracle-X Financial Intelligence Terminal

A unified terminal for equities and digital assets.
Market data, news reasoning and persistent memory in one surface, on an LLM layer you choose — local or cloud.

Architecture Stack AI Engine RAG
Release Platform CI Encrypted keys License PRs Welcome

Table of Contents
  1. Overview
  2. Core Capabilities
  3. System Architecture
  4. Directory Structure
  5. Tech Stack
  6. Installation
  7. Running with Docker
  8. Environment Configuration
  9. API Reference
  10. Quality Gates
  11. Roadmap
  12. Contributing
  13. Security

Overview

Traders, quantitative analysts and financial researchers work across several tools at once: one for equities, another for crypto, a third for charts, and a social feed for sentiment. Each switch costs time, and nothing carries context across the boundary.

Oracle-X is an open-source intelligence terminal that puts those sources on one screen. Real-time WebSockets, background scheduling, a persistent vector store and a provider-agnostic reasoning layer let it do more than display the data — it relates each piece to the history behind it.

The AI layer is local-first but not local-only. The default configuration reasons entirely on your machine through Ollama; a single environment variable switches it to Groq, Gemini, Anthropic, OpenAI or any other supported provider, behind an ordered fallback chain so one provider's outage or rate limit is not the terminal's outage.

Two realms, one terminal. The global board covers digital assets and US equities; a second one covers Borsa İstanbul, in Turkish, against Turkish inflation. They share the shell, the auth layer and the LLM chain and nothing else — different upstreams, different tab set, different language — and a switcher in the nav chrome moves between them. Which realm you are in is read off the path rather than held in a store, so a link lands on the tab set its URL asks for.

Routes. /, /borsa, /developers and /faq are the public site. The global terminal lives under /home, /overview, /dashboard, /analysis, /chat, /heatmap, /live, /derivatives, /chains, /macro, /polymarket, /ownership, /social, /community, /profile and /admin; the BIST realm under /bist, /bist/hisseler, /bist/isi-haritasi, /bist/fonlar, /bist/akilli-para, /bist/kap, /bist/viop, /bist/viop-haritasi and /bist/makro.


Core Capabilities

1. Cross-Asset Market Matrix

Equities and digital assets are treated as one universe rather than two integrations.

  • Equities (NASDAQ/NYSE): live market caps, forward P/E ratios, analyst target bounds, margins and free cash flow, via Yahoo Finance quoteSummary HTTP modules.
  • Digital assets: real-time price streaming and protocol metrics through CoinGecko V3 and the OKX public API.
  • Live asset registry: which coins the overview shows, which stocks the NASDAQ page ranks and which pairs the socket streams are all resolved at runtime from CoinGecko / NASDAQ / OKX, never from a hardcoded list. Resolution degrades through an on-disk cache to a minimal emergency seed, so a cold start during an upstream outage still renders.
  • Asset detail modal: 30+ data points per asset in one view — an equity's debt-to-equity ratio or a protocol's trailing four-week GitHub commit volume, without leaving the chart.
  • Followed-asset brief: the top of /home is three reader-chosen slots, not a wall of market-wide cards. Each carries a price, a sparkline, a liquidity ladder placing the standing leverage above and below spot, and one grounded sentence. The market-wide readings the old block spent a screen on are a single line above it, in the same palette /overview's stats bar uses — a reader who learns the colours on one page should not have to relearn them on the other.
  • Market internals: three panels below the overview table answer what an aggregate stats bar cannot — advancing versus declining counts and the A/D ratio, median against mean against cap-weighted change, volume concentration, a fixed-bucket histogram of 24h moves that doubles as a click-to-filter control on the table above it, and a divergence board of liquid assets whose day contradicts their week. All of it is derived in lib/market-breadth.ts from the payload the table already holds, so the panels cost no extra request. The histogram edges never rescale: an axis that redraws itself cannot be compared to the chart you saw a minute ago, and an empty tail is information.
  • Multi-timeframe technical read: every asset is analysed on three horizons at once — 4h/1d/1w for crypto, 1h/1d/1w for equities — each keeping its own RSI, ATR, trend and swing structure. Support and resistance are returned as zones, not decimals: bands built by clustering swing points within an ATR-scaled tolerance, carrying a touch count and a strength score, so one new candle no longer moves "the level". Weekly history is capped at two years on purpose — a 2017 level describes a market that no longer exists. A timeframe with too little history is dropped and named in coverage rather than extrapolated, and if none survives the endpoint reports a gap instead of a number.

2. News Intelligence Pipeline

Keyword matching produces too many false positives for financial news, so ingestion runs through the model instead.

  • Ingestion: an APScheduler job polls global feeds every NEWS_FETCH_INTERVAL_MINUTES (default 2 min) — Tree of Alpha, Decrypt, CoinDesk, CoinTelegraph, The Block, CryptoSlate, Koin Bülteni and Uzmancoin for crypto; MarketWatch, Investing.com and Seeking Alpha for equities.
  • Semantic ticker extraction: article text is piped through the configured model, and symbol_detection_service fuses that with the live asset registry so headlines map to real tickers. SYMBOL_DETECTION_CONCURRENCY caps concurrency so a 150-item refresh never floods the provider.
  • Attribution memory: a headline's asset is a property of its text, so it is resolved once and cached to disk (news_attribution). A restart does not re-bill the backlog, and a story can no longer be filed under BTC at 10:00 and ETH at 10:02. Results from the degraded heuristic path are marked and revisited.
  • Sentiment scoring: bullish / bearish / neutral with a 0–100 confidence score. With no provider reachable, the pipeline degrades to heuristic extraction rather than failing.
  • Per-article research notes: opening a headline starts a staged pipeline (Gathering evidence → Judging price impact) that fetches the full article body — with a hard timeout, a per-host circuit breaker and paywall-stub rejection — merges it with technical levels and market context, and returns a verdict. Technical levels are copied verbatim from technical_analysis_service; the model is never asked to invent a price. Finished analyses are persisted and keyed by pipeline version, so a prompt edit retires the cache instead of serving stale reasoning indefinitely.

3. RAG Memory Stack (v1 – v5)

A ChromaDB vector store with qwen3-embedding:0.6b embeddings turns every ingested article and price tick into queryable memory. Retrieval is three-stage: vector search fused with BM25 by reciprocal rank, a relevance floor calibrated per collection, then a bge-reranker-v2-m3 cross-encoder that reads the query against each candidate. Measured on backend/evals/golden_set.jsonl, the cross-encoder alone moves recall@5 from 0.79 to 0.96.

  • v1 — outcome memory (rag_service.py): one collection linking historical news to the price outcome that followed. Feeds the /api/analyze flow.
  • v2 — temporal core (rag_v2_service.py): the primary store, split into historical_news, market_events and price_history collections with up to 365 days of indexed history and event correlation.
  • v3 — insights agent: answers "why did BTC move on this date?" — price-movement reasoning, historical news similarity, event-at-date lookup.
  • v4 — reasoning agent: two-asset comparison and what-if scenario simulation.
  • v5 — proactive agent: generates the daily morning brief and flags price-vs-news anomalies without being asked.

Retrieval is scored rather than ranked by proximity alone. rag_scoring.py composes recency (per-collection half-lives), move magnitude, event class and symbol relevance behind a calibrated cosine floor (RAG_MIN_RELEVANCE, measured with scripts/calibrate_rag_relevance.py rather than guessed). rag_outcomes.py measures what an event actually did across 1/7/30/90/180/365-day horizons plus max drawdown and run-up, because a 7-day window labels both the XRP–SEC suit and the NVDA–DeepSeek crash backwards. Precedents whose outcome contradicted their headline are boosted, since those are the ones with something to teach. rag_bellwethers.py bounds the cost by spending that measurement on the assets that set market direction.

4. Oracle Chat Agent

A conversational analyst wired into the memory stack. A turn is not one call to a model — it is intent classification, tool selection, evidence gathering, a bounded self-check, and only then an answer.

  • Intent before tools. chat_intent.py labels each turn as one of thirteen behavioural intents (conceptual, causal, comparative, scenario, macro, derivatives, ownership, portfolio, briefing, …), in Turkish and English side by side. A name only earns a row if it changes which tools are offered or which rules the answer is held to. This is what makes "what is a funding rate" answerable: it resolves no asset, so under the old keyword tables no tool ran, no evidence block was built, and the turn prompt's rule that every figure must appear in context left the model correctly concluding it had nothing admissible to say. evals/eval_refusal.py is the metric for exactly that failure.
  • Conversational focus. chat_focus.py resolves the subject from the recent user turns rather than only the last message, so "peki RSI'ı?" after "BTC nasıl?" still means BTC. Intents that are not about an asset's present state (conceptual, macro, greeting, offtopic, briefing) deliberately clear the inherited focus instead of dragging it forward.
  • Model-chosen tools, from a capped catalogue. CHAT_PLANNER_ENABLED is now on: the model picks from a catalogue filtered by intent and capped at MAX_CATALOGUE_TOOLS (8, or 6 in concise mode) out of ~20 — small enough for a local model to choose well. Every failure path still lands on heuristic_plan, which is itself intent-routed. evals/eval_planner.py measures tool recall and precision before the flag is trusted.
  • A reflection round. CHAT_REFLECTION_ENABLED adds one bounded second look at whether the gathered evidence actually answers the question, and one chance to fix it. Kept behind its own flag so it can be reverted independently of the planner.
  • Cross-session memory. chat_memory_service.py persists the handful of facts that are true across conversations — that someone trades futures rather than spot, that they want short answers — into a narrow key/value table (supabase/migrations/014_chat_memory.sql). The write is proposed by a model, so the shape is the defence: only ALLOWED_KEYS are storable, never free text.
  • Reading pages, not just searching them. The scrape ladder gained a data rung: for hosts that publish a grid of labelled numbers rather than prose (TradingView, Finviz, CoinMarketCap), finance_extractors.py reads the figures out of the HTML the prose extractor would have discarded. read_chart, read_page and social_search — Reddit, X, StockTwits, TradingView — are now actually reachable, bounded by CHAT_MAX_SCRAPES_PER_TURN and CHAT_MAX_BROWSER_PER_TURN.
  • Routes each question across RAG v2/v3/v4 plus live web search, then synthesizes with the configured model. Every leg is time-boxed independently, so a slow source degrades the answer instead of hanging it.
  • Full session management — conversations, message history and renames persist in Supabase. Long turns run as pollable jobs (POST /api/chat/jobs) that can be cancelled.
  • Available as a dedicated page and as a global sidebar from anywhere in the terminal.

5. Staged Market Reports

/api/analysis produces daily / weekly / monthly reports through a four-stage pipeline — collecting → synthesis → drafting → review.

  • Stage 1 is pure Python: analysis_data.py assembles nine independent feeds into one deterministic snapshot and computes breadth, ratios and deltas itself, so arithmetic never reaches the model. A failing feed is recorded in unavailable rather than aborting the run.
  • Stages 2–4 extract evidence, draft the report, then fact-check the draft back against the same snapshot, striking figures the data does not support.
  • Generation is never triggered by a read. Callers POST a job and poll it; a second caller for the same timeframe joins the in-flight run instead of starting a duplicate.

6. Real-Time and Derivatives Data

  • Live price socket: the frontend subscribes to Oracle-X's own /ws/prices endpoint, which fans out ccxt.pro exchange WebSocket streams to every connected client — one upstream connection, N browsers. The venue is configurable via STREAM_EXCHANGE (default OKX, because Binance is unreachable from several countries and fails on load_markets() before a single tick arrives).
  • Liquidation engine: a long-running OKX liquidation WebSocket collector maintains rolling 24h history with disk persistence, powering the live feed and per-symbol levels.
  • Liquidation map: a heatmap rebuilt from free OKX endpoints (candles, open interest, long/short account ratio). It models where leveraged positions would be force-closed — a different thing from the realised-liquidation feed above.
  • Derivatives board (/derivatives): four views of the same leverage, kept apart because they answer different questions. Open interest against price is the input the other three model from — the pairing of the two directions is what says whether a move was positions being opened or closed, and neither column states it alone. The standing liquidation book is drawn against price rather than against time, so the question it answers is how far spot has to travel to reach a wall. Historical lines and the realised feed sit beside it. And the on-chain venue panels name whose book it is: a perpetual DEX publishes its open interest where a centralised venue reports it. Those three rankings are drawn as three panels and never joined into a table — a venue can lead one and be absent from another, and each names its own provider.
  • Funding rates and arbitrage: perpetual funding rates on the home dashboard, plus a CCXT-backed multi-exchange price comparison and arbitrage scanner.

7. Chain Telemetry Board

/chains is the state of the rails underneath the market: eight networks read live, on one board, priced in the coin their fees are actually paid in.

  • Eight chains, four adapter families. Bitcoin, Ethereum, Base, Arbitrum, Optimism, BNB Smart Chain, Solana and Tron, through evm, bitcoin, solana and tron readers behind a single registry.py that holds only protocol constants and endpoints — anything that can differ between two polls is measured, never stored.
  • Comparable fees. The same unit of work priced eight ways: a 21,000-gas native transfer on EVM chains, a 141-vbyte P2WPKH spend on Bitcoin, one signature on Solana. OP-stack rollups add the L1 data fee the block header does not carry, because execution cost alone understates what a transaction there really costs.
  • A gap is rendered as a gap. Arbitrum publishes a gasLimit of 2^50 as a sentinel rather than a capacity, so gasUsed / gasLimit reads 0.00001% and a fullness bar would show a permanently idle chain. Chains flagged gas_ceiling=False report no fullness at all. A labelled gap is honest; a zero is not.
  • Partial failure costs one row. Eight independent providers will not all be up at once, so every adapter is gathered with return_exceptions=True and a failure is recorded as error on that chain alone. The board never 503s, and an unreachable chain is visibly distinct from a quiet one. If the whole assembly fails it replays the last good board rather than returning nothing.
  • Anomaly detection in Python, commentary from the model. anomaly.py computes what is unusual — fees at triple their usual level, load away from baseline, a difficulty swing — and ships each flag with a sentence written in Python, so the board keeps explaining itself with no provider reachable. Two independent baselines, because they fail independently: 30 days of Coin Metrics dailies (works on a cold start), and history.py's own rolling samples, which correct for the fact that request-path sampling is as diurnal as gas prices are.
  • Exchange flows, honestly scoped. Daily BTC and ETH exchange in/outflow from the Coin Metrics Community API. Coverage is two chains because the free tier answers 403 for the rest — the strip names its own limit rather than showing six zeros.

8. Prediction Markets

/polymarket reads the highest-volume open markets on Polymarket and treats a crowd-priced probability as evidence to be examined, not as an answer.

  • Facts before any model. A market's dialog opens on figures computed without an LLM: outcome prices, 24h and 7d drift, volume, liquidity, spread, top-holder concentration, and the dated windows in which the price actually re-priced. moves.py measures those in absolute probability points, never percentages — 0.02 → 0.04 is +100% and means nothing, while 0.45 → 0.62 is 17 points and had a cause. A move must clear both a floor and three times that market's own median move before it is called sharp.
  • The analysis is allowed to refuse. sufficiency.py decides whether the model is asked for a verdict at all, and it is a floor test rather than a weighted score — a score lets a pile of weak amplification outvote real corroboration. Distinct domains is the load-bearing floor, and the app's own RAG output deliberately does not count as a tier-1 source, because prior output cannot corroborate itself. Below the floors the endpoint answers insufficient_evidence and names every search that came back empty, in a paragraph written in Python: a model asked to explain its own thinness writes prose indistinguishable from the analysis it just withheld. The facts and microstructure are served either way, which is what keeps a refusal from reading as a broken page.
  • Claims are pruned mechanically. The model returns {text, sources} objects rather than prose, so dropping an unsupported claim is a lookup and not a judgement. Invented source ids are deleted whole; a claim may cite the market's own price, but only if every figure in it appears verbatim in the rendered facts. Fewer than three survivors discards the synthesis rather than showing it thin, and the panel says how many claims were dropped.
  • Two jobs, never chained. "Why was this bet opened" runs as its own trace, matching dated reporting against the measured move windows, and is allowed to end in a labelled conjecture. It is kept out of the verdict prompt on purpose: by the time a verdict is written, a conjecture is indistinguishable from evidence.
  • Trader geography does not exist, so the map says so. The exchange settles on Polygon and identifies a counterparty only by proxyWallet, so no public endpoint anywhere carries a bettor's location and a bets-by-country choropleth cannot honestly be drawn. The map instead ships three layers that each name their own provenance and refuse to be merged: where it can legally be traded (transcribed from the geoblock list), what the questions are about (volume attributed to the country a question names, split rather than duplicated across multi-country questions), and when the money moves (traded value by hour of UTC day, drawn as bands rather than country shading).
  • Gamma's arrays are strings. outcomes, outcomePrices and clobTokenIds arrive JSON-encoded, so market["outcomePrices"][0] is the character [. Nothing raises; the board simply fills with plausible nonsense. Everything crossing that boundary goes through gamma._maybe_json.

9. Alternative Data

  • Fear & Greed index synchronized across the UI.
  • Macro regime read: macro_regime.py scores equity breadth, the dollar and copper-against-gold — each voting -1/0/+1 through a deadband so a flat tape does not flip the read every refresh — into one word: risk-on, risk-off or neither. The label is computed in Python; the model only writes the sentence explaining it, and never sees a number that has not already been rounded to the grain the label was decided on. Crude is deliberately unscored (rising oil is growth or margin squeeze depending on the cause), and the components the board does not carry — rates, credit spreads, equity volatility — are named in the note rather than papered over.
  • Nothing Ever Happens index: a companion novelty from the same publisher, reading a curated basket of high-impact geopolitical prediction markets rather than pizza queues. The reading is recomputed here from the source's own raw probabilities instead of copied from its gauge, so a change in how the source renders itself cannot silently redefine what the panel claims. It is the highest probability in the basket, never the mean — 27 mostly dormant markets average to a number that never moves, and the point of the gauge is the one market that is moving — and thin markets are excluded, because a 2% print with no depth behind it is a quote, not a probability.
  • Elections board: upcoming national elections worldwide on /macro, with the calendar parsed from Wikipedia's yearly electoral-calendar articles and live odds joined in from Polymarket where a market can be matched to a row with confidence. The match is gated in two tiers: a structured country signal and a plausible resolution date renders a price, and anything weaker renders only a link. Thin markets are demoted to link-only on volume and liquidity floors. The two halves fail independently — losing the calendar is a 503, because an empty board would assert that no election is scheduled anywhere on Earth, while losing the odds is a 200 with a badge saying so. The payload also carries its own coverage cap, since Polymarket's listing is volume-ordered and most calendar rows genuinely having no market is not the same claim as "Polymarket covers nothing".
  • Pentagon Pizza Index: an OSINT novelty gauge derived from late-evening activity at the pizza restaurants around the Pentagon, computed here from each venue's own baseline curve rather than copied from the source's own verdict. It renders as one badge in the nav chrome, at the size a novelty reading earns, and every surface that shows it carries the caveat.
  • On-chain flows: whale transfers and exchange inflow/outflow tracking (optional Etherscan key).
  • Institutional ownership: 13F-style holdings tracking with per-entity boards and historical snapshots, plus a flow note summarising what the tracked institutions actually did last quarter — counted from filed 13F moves only, so a corporate treasury topping up its bitcoin never becomes "institutions bought".
  • Developer velocity and social graph: GitHub commit/issue velocity and community growth surfaced in the asset detail modal.

10. Borsa İstanbul Realm

A second terminal on the same shell, in Turkish, for Borsa İstanbul, TEFAS and the Turkish macro series behind them. It is not the global board with the tickers swapped, because the question is not the same one: a lira figure describes a number of lira, not what they bought, and over the windows this realm reports on — a year, three, five — the difference between those two statements is most of the number.

  • Every return carries a real one. real_return.py deflates each nominal figure in two frames, because they answer different questions: against TÜFE, which says what the money bought, and against USDTRY, which says what it was worth to someone who could have held dollars instead. Neither is "the" answer and the board never picks one silently. A Sharpe ratio computed against a zero risk-free rate is standard practice where the policy rate is 2%; against a TRY policy rate it is arithmetic about a fund nobody could have bought, so the rate is a parameter here rather than a constant.
  • One request is the whole equity board. TradingView's public market scanner returns every listed BIST name with price, volume, market capitalisation, the valuation multiples and the index memberships in a single POST — which is why it is the source and not the four the plan originally called for. KAP's company list moved behind an app that answers an empty array to every request an ordinary client can construct, and borsaistanbul.com publishes constituents as dated files. Sector performance is derived from the constituents rather than read from XUSIN, XUTEK and XGIDA: those exist at the exchange but not in the quote source, and deriving them is both available and closer to the board the reader is looking at. Opening a company therefore costs nothing the screener has not already paid for.
  • The heatmap keeps size fixed. Area is market capitalisation and colour is whichever metric the reader picks — the same division the crypto board makes, for the same reason: the one quantity that should not move when the reader changes the question is size. The toolbar offers four indices of the seven the API accepts; the other three are subsets a reader reaches for by name.
  • Funds: TEFAS for how much, KAP for which. The board is one request for every fund TEFAS lists; a fund's risk statistics need its price series and that endpoint has no bulk form, so they are computed per fund on open. TEFAS publishes a portfolio across 54 instrument codes — drawn literally that is 54 hairline segments and a reader learns nothing — so fund_allocation.py collapses them into a dozen buckets grouped by economic exposure where the field names it and by wrapper where the wrapper is all it names, which is what lets the bar answer the question it exists for: is this an equity fund, a bond fund, or a money-market fund wearing a different name. Which equities a fund holds appears only in its monthly KAP portfolio report, as a PDF whose JSON body carries the cover sheet and not one holding row — so that read is lazy, per fund, cached for a day, and written to refuse rather than to guess.
  • KAP is the primary source, and it is walked, not queried. The disclosure tape has no usable public API: the documented endpoints were retired and the query page streams its rows rather than fetching JSON, so kap_service walks sequential /tr/Bildirim/<index> pages. Sixty rows all look alike — a title, a company, a timestamp — and a capital increase is not close in consequence to a weekly fund form, so kap_materiality.py puts a class and a band on every row without a model: labelling sixty rows with an LLM would run it continuously to produce a column, and the local model is the constraint here. The model writes one thing, on demand — a note on the single filing a reader opened. That note is the only one in the codebase narrating a primary source rather than a board: not "what do these figures mean together" but what a pay geri alım resolution actually does to the share count.
  • Exchange measures come out of the same tape. Circuit breakers, gross settlement and short-selling bans are filed as ordinary disclosures with fixed titles and there is no feed of measures on its own, so they are filtered out of a deliberately over-wide window — a short one returns an empty radar on a quiet morning that is not actually quiet.
  • VİOP is read twice, on purpose. A broker's public page is scraped during the session for nineteen underlyings with no history; Borsa İstanbul's own end-of-day bulletin carries forty-seven single-stock underlyings across three expiries, one file per session, archived years back. Different cadence, shape and failure mode, so they stay separate services. The open-interest column is why the board exists at all: it is the one place in the Turkish market where positioning is published rather than inferred.
  • The margin map is the crypto liquidation map with its weakest joint removed. That model invents how leverage is distributed across users, because no exchange publishes what leverage its users chose. Here the clearing house publishes one Price Scan Range per underlying that binds everyone, every day — so a cohort gets one band and that band sits where a published parameter puts it. Exposure opened, entry price and open-interest change are all read rather than inferred. Two details are load-bearing: the day's SPAN file lives on wwwdata.takasbank.com.tr, a separate host from the bot-protected website, and reading it costs two filters (setlMeth == "DELIV", and a pfCode that does not end in _C) or THYAO's scan range reads 14.0 instead of 13.4. Beside it, spot_volume_profile.py draws where volume was actually traded, from hourly bars over two years — the honest counterpart layer, with nothing modelled.
  • It draws a scan range and says it is not a call level. VİOP publishes no maintenance margin rate: the CCP procedure leaves the level to a General Letter and states maintenance is not applied at end of day, so the price at which a margin call actually triggers cannot be computed from anything public. The "75% of initial" figure that circulates appears only in an undated guide. The page therefore draws the move a position's initial margin was sized for, and says so in as many words.
  • Positioning is narrower than it was meant to be, and says which part. The intent was a fund-to-stock cross index — the Turkish counterpart of the 13F board on the global realm. TEFAS publishes a fund's split by asset class and nothing public names the individual securities behind "hisse senedi %58", so the board that shipped is crowding, futures quadrants, the 52-week range and sector heat, with the gap named rather than approximated.
  • Bilanço restates a level, not a return. Every line of a Turkish statement is stated in the price level of its own quarter, so over the twelve quarters the board draws, the nominal series is mostly a picture of inflation with a company-shaped wobble on it — which is why deflator.py restates each quarter into the newest one's lira by default rather than behind a switch, and serves the nominal figures untouched beside it. That is a different operation from real_return.deflate, which applies the Fisher relation to a return; using either on the other's input produces a plausible number that is wrong. The board also separates what a chart of accounts can carry from what a company filled in, because a bank has no gross profit the way a factory does — "no such line" and "reported nothing" are not the same blank panel.
  • Halka Arz owns the return and not the date. There is no queryable IPO source at Borsa İstanbul: KAP's disclosure query API answers 404, its company list carries no listing date, and the scanner backfills a trailing-year return for all 626 names, so "listed within a year" cannot be inferred either. halkarz_client therefore reads a community-maintained calendar with no contract, parsed by label text rather than DOM position, every field capped and every failure recorded per row in unparsed so parser rot is countable instead of a board that quietly empties. The return the board leads with is computed here from that offering price and our own scanner quote — the number a reader acts on is ours even when the date beside it is not.
  • Ortaklık is fetched once a day and pivoted on read. A hundred İş Yatırım company cards and ten KAP fund reports land in one stored payload; get_board, get_entity and get_asset_owners are pivots over that file and nothing on a request path fetches, which is what lets a company page carry an ownership panel without İş Yatırım's latency becoming the page's. The payload is stored per ticker rather than per entity — the upstream answers "who holds THYAO" — so entities are matched against the registry's aliases on read and a corrected alias takes effect on the next request instead of after the next nightly run.
  • The Radar is a funnel, and zero is an answer. The equity board's snapshot columns gate the whole XU100 with no request at all; daily candles are fetched only for the names that pass; statements come from a quarter-aware disk cache, so after the first scan they cost nothing; and the model is asked to write for the handful of finalists, never to score. A scan that finds no pullback inside an uptrend says so and names the closest misses rather than lowering the bar until something passes.
  • Macro degrades to keyless. With no configuration at all the realm reads the inflation rate, the policy rate and the exchange rate from the same scanner the equity board uses — enough for the figure that matters most, a one-year return deflated by one-year inflation, and for dollar-based returns over any window from a public USDTRY chart endpoint.
  • Gece Mesaisi Endeksi. This realm's answer to the Pentagon Pizza Index, and the same class of claim: how hard the state is legislating today, read off the Resmî Gazete, and whether anything was urgent enough to skip the queue. Like the pizza gauge its endpoint cannot fail — it feeds a badge in the chrome of every BIST page, so a government site that stops answering must not be able to take those pages down with it, and the service answers unavailable for the badge to render as its own state.
  • Two Turkish details that fail silently if you get them wrong. str.casefold cannot know which language it is looking at, so "KESİCİ" folds to an ASCII i followed by a combining dot while "Kesici" folds to plain kesici — the two never match, and no error is raised; text.py does the folding for the whole package. And www.resmigazete.gov.tr and www.tccb.gov.tr send their leaf certificate and stop, omitting the intermediate: browsers fetch the missing one from the leaf's AIA extension and httpx does not, so every request failed while the same URL opened fine in a browser.

11. Grounded Notes

Ten surfaces — the macro, chain and ownership boards, the followed-asset brief, and five on the BIST realm — render deterministic figures and used to leave the reader to work out what they meant. services/ai_notes.py closes that gap without moving any arithmetic into the model.

  • Each caller computes its own labels, thresholds and deltas in Python and hands the engine a finished set of facts. The model's only job is to say what they mean in a sentence or two.
  • Facts are the cache key. A note is fingerprinted by the prompt it was written from and the facts it was written about, so identical facts reuse the note and a prompt edit retires every note derived from it — the same discipline the news-analysis cache uses.
  • A missing note is never an error state. It is commentary on figures that are always present, so a page with no note is still complete. lib/ai-note.ts holds that branch on the frontend, where it is tested.
  • Figures are quantized before they are fingerprinted, and the prompt is rendered from those same rounded values — so a cached note cannot cite a number that has since moved a decimal place under it.
  • One note is not commentary on a board. prompts/notes/kap_disclosure.md narrates a company's own filing, in its own words, which the tape prints as a title and leaves unexplained. Every other note explains figures the reader can already see; that one explains a mechanism they may not carry.

12. Accounts, Community and Bring-Your-Own-Key

  • Supabase Auth (email/password and Google OAuth). Authorization is enforced in the application layer (dependencies/auth.py): the backend holds the service-role key and therefore bypasses RLS, so every user-scoped endpoint takes its identity from a verified bearer token, never from a client-supplied user_id.
  • A community feed with posts, threaded comments, likes and moderation, plus an admin surface with audit logging.
  • User profiles carrying subscription tier, connected accounts, preferences and an AI query quota.
  • Per-user LLM settings: each user can pick their own provider and model and supply their own API key, scoped to chat, news and/or reports. Keys are encrypted with Fernet before they reach Supabase (services/secret_box.py) and are returned to the UI only as a hint, never in plaintext.

13. Alarm Centre

The bell in the nav chrome opens a workspace for watching twelve sources — price, 24h change, BTC dominance, funding, liquidations, Fear & Greed, the Nothing Ever Happens index, chain anomalies, the Pentagon Pizza Index, news keywords, macro events and prediction markets — under four kinds of condition: a threshold, a server-computed state, a keyword match, or a countdown to an event.

  • Evaluation is entirely client-side. useAlarmEngine ticks once every 15 seconds and reads through the React Query cache using each source's own interval as staleTime, so an alarm piggybacks on requests the terminal was making anyway instead of opening its own. The decision itself is a pure function in lib/alarms/evaluate.ts returning trigger / rearm / none, which is where it is tested; the hook makes no decisions.
  • Nothing fires twice for one move. A latched hysteresis band, sized as a fraction of the threshold so the same constant works for a 0.0001 funding rate and a six-figure BTC price, plus a bounded dedupe ring for event-shaped readings and a per-alarm cooldown. A stale reading never re-triggers, and a source reporting unavailable counts as no reading rather than as zero.
  • Mail is the only part the backend touches. routers/alarms.py exists because a browser cannot speak SMTP. An address confirms itself with a code first; the browser then holds an HMAC bound to that address, compared in constant time; and the message body is composed server-side from a Jinja template. A stolen token therefore buys nothing but alarm-shaped mail to its own inbox. Delivery stays off until SMTP_HOST is set — an admin can set it from the panel or from the environment — and the UI hides the panel rather than offering a button that cannot work.
  • The other three channels need no configuration at all. A toast, a Web Audio beep and an OS notification fire locally; mail is a fourth, sent fire-and-forget so a slow relay never delays the alarm itself.
  • Alarms live in the browser, not the database. No migration, no table: definitions, history and the confirmed address persist to localStorage. The store carries a versioned migration that folds the old single-symbol price alerts into the new model and deletes the dead key, because persist shallow- merges and would otherwise resurrect it forever.

14. Boot Gate

A cold start touches a dozen upstreams. Rather than assembling itself panel by panel over half a minute, the terminal holds its first paint on /api/system/readiness and shows one splash with named steps (asset registry, liquidation stream, news, model warm-up, RAG embeddings). Required steps block; optional ones only mark the session degraded. The endpoint is pure in-memory state — it is polled twice a second — and nothing in the startup path blocks the socket from binding.

15. Public Site

Four pages sit outside the terminal, in a route group with no navigation chrome and no boot gate — they share fonts and design tokens with the terminal and nothing else, and three of the four render with the backend down.

  • / — the tour. A scroll-driven page rendered on a single position: fixed 2D canvas. lib/landing/stages.ts is the one source of truth: each stage's height in svh sizes both the DOM section and the canvas window it maps to, so the copy and the chart it annotates cannot drift apart. The candle series is generated from a seed rather than Math.random, so the page draws identically on every mount.
  • /borsa — the BIST realm's own page, and the one exception. A light Turkish document on cool paper where / is a dark scroll-driven scene in English: the thesis is that a Turkish return is read twice, so the hero figure physically turns over from a nominal gain into what it was worth and prints the division under it. It is the only marketing page that reads live data — BIST, the fund board, positioning and the KAP tape — so it brings its own QueryClientProvider rather than pulling the whole marketing group into the terminal's shell for one page, and it names its coverage where the figures come from.
  • /developers — building against it. Eight documented sections, each with a generated margin figure: the provider chain, the health categories, the MCP tool surface, the test suites.
  • /faq — what it will not claim. Eighteen deep-linkable entries on the limits, the data handling and the coverage, which is the part of a financial tool most worth writing down.
  • Every number on these pages is generated. lib/marketing/ holds the prose and is tested for one rule beyond correctness: it carries no digits. Figures come from lib/generated/repo-facts.ts, measured by the collectors described under Quality Gates, so a claim that stops being true fails CI instead of quietly ageing.
  • The tab underline lives in the layout, not the page. A per-page header remounted the bar already at its destination and the transition never ran; its position is measured from the active tab's own box through a ResizeObserver, because the font swap changes tab widths after first paint.

System Architecture

Frontend and backend are strictly decoupled: the UI never blocks on a slow upstream, and the API never renders.

graph TD;
    subgraph Client [Frontend - Next.js 15 App Router]
    Landing["(marketing) - tour, borsa, developers, FAQ"]
    Gate[BootGate + readiness poll] --> UI[React Interface - 2 realms]
    UI --> Alarms[Alarm engine - client-side, 15s tick]
    UI --> RQ(React Query - server state)
    UI --> Zustand(Zustand - client state)
    UI --> Auth[Supabase Auth Context]
    end

    subgraph API [FastAPI Gateway - Python]
    Router[25 API Routers] --> Manager[Service Layer]
    Manager --> LLM[LLM provider chain]
    Manager --> RAG[(ChromaDB - RAG v1/v2)]
    Manager --> Cache[(TTL Cache + stale fallback)]
    Manager --> Sched[APScheduler Jobs]
    Manager --> Jobs[Background analysis jobs]
    Manager --> WSS[ccxt.pro Stream Fanout]
    end

    subgraph Brain [Reasoning - ordered fallback chain]
    OL[Ollama - local]
    CLOUD[Groq / Gemini / OpenAI / Anthropic / ...]
    end

    subgraph Data [Persistence]
    SB[(Supabase Postgres + RLS)]
    end

    subgraph External [External Oracles]
    CG[CoinGecko API]
    YF[Yahoo Finance]
    OKX[OKX REST + WS]
    RSS[Global RSS + Tree of Alpha]
    FG[alternative.me Fear & Greed]
    DDG[DuckDuckGo Search]
    RPC[8 chain RPC / REST endpoints]
    CM[Coin Metrics Community]
    PM[Polymarket Gamma / CLOB / Data]
    WIKI[Wikipedia electoral calendars]
    TR[TradingView scanner / TEFAS / KAP]
    TB[Takasbank SPAN + VIOP bulletin]
    RG[Resmi Gazete]
    SMTP[SMTP relay]
    end

    UI ===|REST JSON| Router
    Gate ===|/api/system/readiness| Router
    UI ===|WebSocket /ws/prices| WSS
    Alarms ===|POST /api/alarms/email/notify| Router
    Auth === SB
    Manager === SB
    Manager === External
    LLM --> OL
    LLM --> CLOUD
    Sched --> RAG

    style UI fill:#000000,stroke:#38B2AC,stroke-width:2px,color:#fff
    style Router fill:#009688,stroke:#fff,stroke-width:2px,color:#fff
    style LLM fill:#000000,stroke:#fff,stroke-width:2px,color:#fff
    style RAG fill:#FF6F00,stroke:#fff,stroke-width:2px,color:#fff
Loading

Directory Structure

Backend (FastAPI)

backend/
├── main.py                     # ASGI factory, lifespan warm-up, CORS, GZip, router injection
├── config.py                   # pydantic-settings Settings singleton (reads backend/.env)
├── pyproject.toml              # version, ruff (line-length 100) and pytest configuration
├── requirements.txt            # runtime dependencies
├── requirements-dev.txt        # test + lint deps only — CI installs these, not torch
├── .env.example                # environment template — copy to .env
├── dependencies/
│   └── auth.py                 # bearer-token verification; the authorization boundary
├── models/
│   └── schemas.py              # Pydantic request/response models
├── prompts/                    # prompt templates as plain Markdown, {{placeholder}} syntax
│   ├── analysis/               # stage1_evidence, stage2_report, stage3_review, system_analyst
│   ├── chat/                   # system, turn, plan, plan_system, reflect, reflect_system
│   ├── chains/anomaly.md       # what co-occurring chain flags mean
│   ├── macro/regime.md         # the sentence behind the risk-on/off label
│   ├── notes/                  # rules.md (shared grounding) + seven note prompts;
│   │                           # the other three live beside their own domain:
│   │                           # asset_brief, bist_brief, bist_market,
│   │                           # bist_funds_market, bist_positioning, bist_viop,
│   │                           # kap_disclosure — the only one over a primary source
│   ├── ownership/flow.md       # last quarter's institutional moves, in prose
│   ├── polymarket/             # forecaster system, rules, arguments, synthesis,
│   │                           # synthesis_degraded, origin + six category overlays
│   └── news/ detection/ generic/
├── templates/email/            # Jinja alarm + verification mail (table layout, escaped)
├── routers/                    # 26 modules — full paths inline, no prefixes
│   ├── news.py                 # /api/news, /api/analyze, /api/symbols, /api/technical
│   ├── llm.py                  # /api/llm/status
│   ├── system.py               # /api/system/readiness, /api/system/health
│   ├── market.py               # /api/fear-greed, /api/market-overview, /api/heatmap/data
│   ├── liquidation.py          # /api/liquidations/* (heatmap, map, lines, profile,
│   │                           # levels, history), /api/market/candles
│   ├── derivatives.py          # /api/derivatives/open-interest, /dex-perps
│   ├── home.py                 # /api/home/* (funding, onchain, macro calendar)
│   ├── macro.py                # /api/macro/* (board, regime, pizza-index, neh-index,
│   │                           # elections)
│   ├── chains.py               # /api/chains/board, /api/chains/anomalies
│   ├── bist.py                 # /api/bist/* — the whole Turkish realm, 32 routes
│   ├── polymarket.py           # /api/polymarket/* (board, map, market, analysis, origin)
│   ├── alarms.py               # /api/alarms/email/* — the mail relay a browser cannot be
│   ├── watchlist.py            # /api/home/watchlist CRUD
│   ├── analysis.py             # /api/analysis/reports, /api/analysis/jobs, notes
│   ├── rag.py                  # /api/rag/* (initialize, query, insights, scenario, brief)
│   ├── chat.py                 # /api/chat, sessions, message history
│   ├── auth.py                 # session verification helpers
│   ├── profile.py              # /api/profile/* (settings, subscription, quota, BYO-key)
│   ├── community.py            # /api/community/posts, comments, likes
│   ├── social.py               # /api/social/* (sentiment, follows, public profiles)
│   ├── ownership.py            # /api/ownership/* (institutional holdings, snapshots)
│   ├── bist_ownership.py       # /api/bist/ownership/* plus the admin refresh route
│   ├── live.py                 # /api/live/* (streams, events)
│   ├── admin.py                # /api/admin/* (moderation, audit log)
│   ├── exchanges.py            # /api/exchanges, /api/multi-exchange, /api/arbitrage
│   └── websocket.py            # /ws/prices, /api/websocket/status
├── services/                   # business logic — 88 modules plus admin/, bist/,
│   │                           # chains/, community/, elections/, llm/,
│   │                           # ownership/, polymarket/ and social/ packages
│   ├── llm/                    # provider abstraction
│   │   ├── presets.py          # 14 provider rows (adapter, base_url, default model, key env)
│   │   ├── providers.py        # openai_compat / anthropic / ollama adapters
│   │   ├── client.py           # chain resolution, retries, rate-limit + daily-quota cooldowns
│   │   └── user_prefs.py       # per-user provider override resolution
│   ├── secret_box.py           # Fernet encryption for per-user API keys
│   ├── llm_settings_service.py # per-user provider/model/key persistence
│   ├── ai_service.py           # prompt assembly, response parsing, fallbacks
│   ├── prompts.py              # file-backed prompt loader ({{name}} substitution)
│   ├── prompt_budget.py        # token-ceiling context fitting
│   ├── readiness.py            # startup step tracking for the boot gate
│   ├── asset_registry.py       # live coin/stock/pair universe + disk cache + seed
│   ├── analysis_data.py        # deterministic market snapshot (no LLM)
│   ├── analysis_service.py     # four-stage market report pipeline
│   ├── analysis_jobs.py        # in-process job runner with stage progress + partials
│   ├── news_service.py         # RSS + Tree of Alpha aggregation
│   ├── article_service.py      # full-article extraction (timeout, breaker, paywall reject)
│   ├── news_analysis_service.py / news_analysis_store.py   # per-article research notes
│   ├── news_attribution.py     # persistent headline → asset memory
│   ├── symbol_detection_service.py  # LLM + registry ticker resolution
│   ├── rag_service.py          # RAG v1 — outcome memory
│   ├── rag_v2_service.py       # RAG v2 — temporal core (3 collections)
│   ├── rag_v3_service.py / rag_v4_service.py / rag_v5_service.py   # agent layer
│   ├── rag_scoring.py          # pure composite relevance/importance scoring
│   ├── rag_outcomes.py         # multi-horizon outcome measurement
│   ├── rag_bellwethers.py      # curated direction-setting asset universe
│   ├── chat_service.py         # Oracle chat orchestration (RAG + web search + LLM)
│   ├── chat_intent.py          # 13 behavioural intents; decides tools and answer rules
│   ├── chat_focus.py           # what the conversation is about, across turns
│   ├── chat_planner.py         # model-chosen tool plan from an intent-filtered catalogue
│   ├── chat_tools.py           # the tool catalogue and its executors
│   ├── chat_memory_service.py  # per-user facts that survive the session (ALLOWED_KEYS)
│   ├── ai_notes.py             # grounded note engine — facts in, one paragraph out
│   ├── macro_regime.py         # risk-on / risk-off scored in Python, explained by the model
│   ├── pentagon_pizza_service.py    # the OSINT novelty gauge, computed not copied
│   ├── finance_extractors.py   # labelled figures from table-shaped pages (TradingView, ...)
│   ├── scrape_service.py       # the fetch ladder: direct → impersonated → data → browser
│   ├── chains/                 # per-chain telemetry
│   │   ├── registry.py         # the 8 chains: protocol constants and endpoints only
│   │   ├── evm.py / bitcoin.py / solana.py / tron.py   # the four adapter families
│   │   ├── service.py          # parallel read, fee pricing, board assembly
│   │   ├── history.py          # rolling baseline, diurnally corrected
│   │   ├── anomaly.py          # what is not normal, found in Python
│   │   └── flows.py            # Coin Metrics daily exchange flow (BTC/ETH)
│   ├── polymarket/             # prediction markets
│   │   ├── gamma.py / clob.py / data_api.py   # three public APIs, two id spaces
│   │   ├── registry.py         # category tags, prompts and per-category thresholds
│   │   ├── facts.py / moves.py # model-free figures; sharp moves in probability points
│   │   ├── sufficiency.py      # the floors below which no verdict is asked for
│   │   ├── evidence.py / feeds.py / synthesis.py / attribution.py
│   │   ├── origin.py           # why this bet was opened — its own job, never chained
│   │   └── map_service.py / jurisdictions.py / geography.py   # three labelled layers
│   ├── bist/                   # Borsa İstanbul, TEFAS and the Turkish macro series
│   │   ├── tradingview_client.py / tefas_client.py   # shape adapters, nothing else
│   │   ├── equity_service.py   # the board; sectors derived from constituents
│   │   ├── heatmap_service.py  # area is cap, colour is the reader's question
│   │   ├── fund_service.py / fund_metrics.py / fund_allocation.py
│   │   ├── kap_fund_client.py / fund_holdings.py / holdings_service.py
│   │   │                       # which equities a fund holds — a monthly PDF
│   │   ├── kap_service.py      # the disclosure tape, walked page by page
│   │   ├── kap_materiality.py  # class and band on sixty rows, without a model
│   │   ├── kap_note.py         # the one note written over a primary source
│   │   ├── viop_service.py     # the in-session scrape: 19 underlyings, no history
│   │   ├── viop_bulletin.py    # the exchange's own EOD file: 47, three expiries
│   │   ├── takasbank_psr.py    # the published scan range the map's bands sit at
│   │   ├── viop_margin_map.py  # accumulate-and-sweep, but every input is read
│   │   ├── spot_volume_profile.py   # where volume actually traded — nothing modelled
│   │   ├── positioning_service.py   # crowding, quadrants, range, sector heat
│   │   ├── macro_service.py / real_return.py   # the deflators every return carries
│   │   ├── night_shift_service.py   # Gece Mesaisi — the endpoint that cannot fail
│   │   ├── sentiment_service.py / calendar_service.py
│   │   ├── brief_note.py / market_note.py / positioning_note.py / viop_note.py
│   │   ├── text.py             # Turkish folding — casefold gets İ/I wrong silently
│   │   └── gov_tls.py          # the gov hosts omit their intermediate certificate
│   ├── elections/              # wikipedia.py, odds.py, registry.py, join.py
│   ├── neh_index_service.py    # Nothing Ever Happens — recomputed, not copied
│   ├── alarm_email_service.py  # confirmation codes, HMAC tokens, per-address caps
│   ├── email_delivery.py       # smtplib in a thread; SPF/DKIM-aligned headers
│   ├── mail_settings_service.py    # admin-set SMTP, Fernet-encrypted, 0600 on disk
│   ├── email_guard.py          # MX check + disposable-domain blocklist
│   ├── ownership/flow_note.py  # last quarter's 13F moves, aggregated not recomputed
│   ├── okx_market.py           # single client for prices, candles, trades
│   ├── price_service.py        # server-side single-symbol price resolution
│   ├── liquidation_service.py  # OKX liquidation WS collector (persisted)
│   ├── liquidation_map_service.py  # modelled liquidation heatmap from free OKX data
│   ├── websocket_service.py    # ccxt.pro price stream fanout
│   ├── ccxt_service.py         # multi-exchange REST + arbitrage
│   ├── asset_detail_service.py # 30+ field aggregator for the detail modal
│   ├── market_overview_service.py / stock_market_service.py / heatmap_service.py
│   ├── fear_greed_service.py / onchain_service.py / technical_analysis_service.py
│   ├── web_search_service.py   # DuckDuckGo search for the chat agent
│   ├── supabase_service.py / profile_service.py / watchlist_service.py
│   ├── scheduler_service.py    # APScheduler: news fetch, RAG re-index, elections warm
│   ├── http_client.py          # shared async httpx client (+ impersonated transport)
│   └── cache.py                # ServiceCache (TTLCache) with stale-data fallback
├── evals/
│   ├── golden_set.jsonl        # retrieval evaluation set
│   ├── eval_planner.py         # tool-selection recall and precision
│   └── eval_refusal.py         # how often the chat declines a question it could answer
├── scripts/verify_migrations.py     # are the migrations in the repo actually live?
├── tests/                      # 149 pytest modules — run in CI
└── data/                       # local JSON state + ChromaDB stores (gitignored)

Frontend (Next.js 15 App Router)

frontend/
├── next.config.js              # strict mode + /api/* rewrite proxy to the backend
├── tailwind.config.ts          # UI token system, custom hex colors
├── tsconfig.json               # strict TypeScript compilation
├── vitest.config.ts            # unit test runner
├── .eslintrc.json / .prettierrc
├── .env.example                # copy to .env.local
├── app/
│   ├── layout.tsx              # fonts, tokens, metadataBase, AuthProvider, HydrationBeacon
│   ├── opengraph-image.tsx     # the link-preview card, rendered from the landing palette
│   ├── globals.css             # token definitions + terminal and landing styles
│   ├── (marketing)/            # the public site — renders with the backend down
│   │   ├── layout.tsx          # MarketingShell: header + tabs, so the underline persists
│   │   ├── page.tsx            # / — the scroll-canvas tour
│   │   ├── borsa/              # /borsa — the BIST page; the one that reads live data
│   │   ├── developers/         # /developers — eight doc sections with generated figures
│   │   ├── faq/                # /faq — eighteen deep-linkable entries
│   │   └── error.tsx           # its own boundary; (app)'s uses h-full, which is 0 here
│   └── (app)/                  # the terminal — route group, absent from the URL
│       ├── layout.tsx          # ClientShell composition
│       ├── home/               # home dashboard (/home)
│       ├── overview/           # cross-asset market matrix
│       ├── dashboard/          # news + charts + Oracle panel
│       ├── analysis/           # AI timeframe reports and notes
│       ├── chat/               # Oracle chat agent
│       ├── live/               # live streams and events
│       ├── derivatives/        # open interest, liquidation book and on-chain venues
│       ├── chains/             # eight-chain telemetry board
│       ├── bist/               # the Turkish realm — its own tab set, read off the path
│       │                       # hisseler/[ticker], isi-haritasi, fonlar/[kod],
│       │                       # akilli-para, kap, viop, viop-haritasi, makro,
│       │                       # bilanco, halka-arz, ortaklik, radar, admin
│       ├── macro/              # macro calendar, regime read, elections and dashboard
│       ├── polymarket/         # prediction-market board, map and bet analysis
│       ├── ownership/          # institutional holdings
│       ├── social/             # sentiment and public profiles
│       ├── community/          # social feed and post detail
│       ├── profile/            # account, subscription, AI provider settings
│       ├── admin/              # moderation and audit
│       ├── u/[userId]/         # public user profile
│       └── auth/ error.tsx
├── components/
│   ├── ClientShell.tsx         # QueryClientProvider + Navigation + GlobalTicker + Toasts
│   ├── HydrationBeacon.tsx     # proof of life for the chunk-recovery watchdog
│   ├── BootGate.tsx / BootSplash.tsx   # holds first paint until the backend is ready
│   ├── RealmSwitcher.tsx       # global ⇄ BIST; the same control on both sides of the app
│   ├── landing/                # ScrollCanvas, TypedPoints, StageFigure, hero and sections,
│   │                           # plus the doc shell (DocPage, DocRail, FaqList, figures/)
│   ├── borsa/                  # /borsa — RealReturnHero, FlipFigure, LiveBlocks, SessionRail
│   ├── bist/                   # the Turkish realm's pages, ribbon, notes and panels,
│   │                           # plus heatmap/, positioning/ and viop/ subtrees
│   ├── ui/                     # Panel, Modal, Logo, AssetTag, ShinyText, AiNote, DataTable,
│   │                           # AssetLogo, ToggleGroup, StaleStrip, StatusMessage
│   ├── chains/                 # ChainCard, BlockStream, FeeRacer, EconomicsPanel,
│   │                           # FlowStrip, AnomalyBanner, DeviationBanner
│   ├── analysis/               # ReportView, AnalysisProgress, StageChecklist, NotesPanel,
│   │                           # TechnicalPanel, ZoneLadder, TimeframeGrid, RangeStrip
│   ├── polymarket/             # MarketCard, MarketDetail, AnalysisPanel, OriginPanel,
│   │                           # WorldMap (ECharts, dynamic — 370KB stays off first paint)
│   ├── overview/               # AdvancedHeatmap, AssetDetailModal, AssetTable,
│   │                           # MarketBreadthStrip, ChangeDistribution, DivergenceBoard
│   ├── home/                   # AssetBrief + BriefChart + LiquidityLadder, MarketRibbon,
│   │                           # FundingRates, LiquidationFeed, Watchlist, ...
│   ├── charts/                 # OpenInterestBoard, LiquidationProfile / Lines / Maps,
│   │                           # DexPerpBoard — ECharts, all dynamic
│   ├── macro/ live/ ownership/ social/ admin/ chat/
│   ├── PizzaIndexBadge.tsx     # the novelty gauge, in the nav chrome
│   ├── alarms/                 # AlarmBell in the nav chrome + the Alarm Centre dialog;
│   │                           # entirely modal, there is no /alarms route
│   ├── profile/AIProviderSettings.tsx   # BYO provider/model/API key UI
│   ├── community/              # PostCard, PostMedia, CreatePostModal
│   └── NewsFeed.tsx / ChartPanel.tsx / OraclePanel.tsx / ChatSidebar.tsx / ...
├── contexts/AuthContext.tsx    # Supabase session, signIn/signUp/signOut/OAuth
├── hooks/
│   ├── queries.ts              # React Query keys + typed hooks (optimistic mutations)
│   ├── useReadiness.ts         # /api/system/readiness poller for the boot gate
│   ├── useWebSocketPrices.ts   # /ws/prices client, reconnect + flash animation
│   ├── useAlarmEngine.ts       # global alarm watcher — one tick, twelve sources
│   └── useBist.ts              # the BIST realm's bindings, kept off `queries.ts`
├── lib/
│   ├── api.ts                  # fetch wrapper, ApiError, typed endpoint fetchers
│   ├── queryClient.ts          # QueryClient + global error → toast wiring
│   ├── supabase.ts             # lazy browser Supabase client
│   ├── chain-format.ts         # five orders of magnitude of fees in one column (tested)
│   ├── technical-format.ts     # a band is rendered as a band, never averaged (tested)
│   ├── ai-note.ts              # the shared envelope every generated note arrives in (tested)
│   ├── pizza-index.ts          # one set of thresholds for all three surfaces (tested)
│   ├── alarms/                 # what can be watched, and when it fires (tested)
│   ├── market-breadth.ts       # advance/decline, histogram, divergence (tested)
│   ├── bist-*.ts               # format, brief, heatmap, kap, viop, positioning,
│   │                           # market-note, fund-allocation, viop-map (all tested)
│   ├── night-shift.ts          # Gece Mesaisi thresholds, shared by badge and page (tested)
│   ├── nav-items.ts            # the two realms and their tab sets (tested)
│   ├── chart-palette.ts        # ECharts paints to canvas and canvas ignores var()
│   ├── open-interest.ts / liquidation-profile.ts / liquidation-lines.ts /
│   │   dex-perps.ts            # the derivatives board's derivations (tested)
│   ├── asset-brief.ts / asset-search.ts / asset-logo.ts   # the Home slots (tested)
│   ├── borsa/                  # the /borsa page's deflation arithmetic (tested)
│   ├── polymarket-format.ts    # probabilities, points, provenance labels (tested)
│   ├── elections.ts            # UTC-anchored countdowns, both sides (tested)
│   ├── marketing/              # the marketing prose — tested to carry no digits
│   ├── generated/repo-facts.ts # every number the public pages state (generated)
│   └── landing/                # scroll canvas engine — stages, series, renderer (tested)
├── assets/og/                  # subset JetBrains Mono faces for the OG image renderer
├── public/landing/             # stage imagery + CREDITS.md
└── store/useStore.ts           # Zustand global client state

Repository Root

.
├── start.sh / start.bat        # launchers (venv, ports, both servers, RAG seed)
├── docker-compose.yml          # production-shaped stack
├── docker-compose.override.yml # dev overrides (bind mounts, --reload, next dev)
├── docker-compose.tls.yml      # server overlay: Caddy, and no published app ports
├── Caddyfile                   # TLS, one origin, backend under /api and /ws
├── docs/DEPLOY.md              # putting it on a server, start to finish
├── supabase/migrations/        # 001_initial_schema → 018_ai_usage
├── .claude-plugin/             # Claude Code marketplace: three installable plugins
├── agent-skill/                # three AgentSkills for external coding agents
│   ├── oracle-x-api/           # reading a running instance
│   ├── oracle-x-dev/           # extending this codebase
│   └── *.zip                   # generated, for direct download
├── agents/                     # three subagents; here because the loader looks nowhere else
├── plugins/                    # slash commands and hook scripts for the plugins
├── mcp-server/                 # the same API as 36 MCP tools
│   └── oracle_x_mcp/           # stdio server; talks HTTP to a live instance
├── scripts/
│   ├── build_agent_skill.py         # regenerates the skill's endpoint reference
│   ├── build_repo_facts.py          # regenerates the numbers the public pages state
│   ├── _openapi.py                  # builds the app in-process for both of the above
│   ├── calibrate_rag_relevance.py   # measures the RAG relevance floor against your store
│   ├── fetch_landing_imagery.sh     # rebuilds the landing imagery set from Wikimedia
│   └── generate_brand_assets.py
├── .github/workflows/
│   ├── ci.yml                  # ruff + compileall + pytest | lint, typecheck, test, build
│   │                           # | generated files | mcp-server
│   └── publish-packages.yml    # builds + pushes both images to ghcr.io
└── .pre-commit-config.yaml     # ruff (backend) + prettier (frontend) + hygiene hooks

Tech Stack

UI Layer (Next.js 15 App Router)

  • Framework: SWC-compiled builds; server components keep client bundles lean.
  • Server state (React Query): every backend read goes through @tanstack/react-query with a central key registry (hooks/queries.ts), 30s stale time, exponential-backoff retries and a global error handler that surfaces failures as toasts (lib/queryClient.ts). Mutations such as watchlist deletion are optimistic with automatic rollback.
  • Client state (Zustand): the Context API re-renders the whole subtree. Zustand binds real-time WebSocket price updates to individual components without re-rendering the heatmap.
  • Styling (Tailwind CSS): no component library — a token system and a small set of shared primitives in components/ui, for exact control over a dense dark interface.
  • Charting: Apache ECharts for the data-dense panels — liquidation heatmap and book, open interest, treemaps, the VİOP margin map — and embedded TradingView widgets for classic price action. Every ECharts panel is a dynamic() import with ssr: false: the library is ~350 kB, which put one route's first load at 534 kB against 103–182 kB for every page that does not chart, and the palette is resolved from the live document, so a server render would paint the chart in fallback colours and then repaint it.

API Engine (FastAPI, Python 3.11+)

  • Asynchronous IO: the backend is async def throughout. Outbound calls share one configured httpx.AsyncClient (services/http_client.py); blocking work is dispatched to thread pools so the event loop never stalls.
  • Non-blocking startup: uvicorn binds its socket before any warm-up runs. Registry priming, model loading, the first news fetch and embedding warm-up execute as tracked background tasks that report into readiness, so the boot gate can poll from the first second.
  • Configuration (pydantic-settings): a cached Settings singleton reads backend/.env, exposing typed feature flags, intervals, provider chains and CORS origins, and failing fast at startup when Supabase credentials are absent.
  • Caching: a cachetools-backed ServiceCache with per-service TTLs and stale-data fallback — if an upstream rate-limits, the last good payload is served instead of an error.
  • Transport realism: a curl_cffi transport replays a browser TLS/HTTP2 fingerprint for the few upstreams that fingerprint the handshake (CNN's Fear & Greed feed, Yahoo's chart API) and answer 418 to ordinary clients regardless of User-Agent. A second, narrower case sits beside it: the Turkish government hosts send their leaf certificate and stop, and where a browser repairs the chain from the leaf's AIA extension, httpx does not — so bist/gov_tls.py supplies the missing intermediate rather than disabling verification.
  • Scheduling and jobs: APScheduler drives periodic news ingestion and RAG re-indexing; analysis_jobs runs the long LLM pipelines out of the request path with pollable stage progress.

The Reasoning Layer

  • 13 providers, one interface. ollama, groq, gemini, openai, anthropic, openrouter, deepseek, together, mistral, xai, cerebras, fireworks and perplexity, beside a fourteenth custom row for any self-hosted vLLM / LM Studio / LiteLLM proxy — which the collectors do not count as a provider, so repo-facts.ts says thirteen. Adding one is a row in presets.py, not new code, as long as it speaks the OpenAI chat-completions format — which nearly all of them do. Two adapters cover the rest: Ollama's native API, and Anthropic's /v1/messages (its OpenAI shim is documented as beta and not intended for production).
  • Ordered fallback chain. LLM_PROVIDER names the primary and LLM_FALLBACK_PROVIDERS the chain behind it. An entry is skipped when it is unreachable, its key is missing, its model id is unknown, or it is still rate-limited after its retries.
  • Rate limits are first-class. A 429 with a stated delay is waited out only if it fits LLM_RATE_LIMIT_MAX_WAIT; otherwise the chain moves on and that provider goes on cooldown, because free tiers count rejected calls against the same quota. A spent daily budget gets a much longer cooldown (LLM_DAILY_QUOTA_COOLDOWN), since providers report it as if it were a rolling minute.
  • Local-first defaults. With LLM_PROVIDER=ollama, headlines, portfolios and chat questions never leave the machine. qwen3.6:35b-a3b (MoE, ~3B active params) is the recommended default; qwen3.5:9b fits lighter hardware. OLLAMA_KEEP_ALIVE keeps the model resident so a quiet period is not followed by a reload that times out every racing call.
  • Prompts live in files. backend/prompts/**.md with {{placeholder}} substitution — reviewable and tunable without touching Python.
  • Graceful degradation. Every LLM call has a fallback path, so the terminal stays usable with no provider at all: you lose AI scoring and chat, not market data.
  • Embeddings run through the local Ollama daemon (qwen3-embedding:0.6b, 1024-dim, multilingual), warmed at startup. The cross-encoder reranker loads on CUDA / MPS / CPU depending on the host.
  • The prompt is budgeted, not truncated. Ollama cuts an over-long prompt from the front, and the system prompt renders first — so an overflow silently deletes the rules that forbid invented figures. services/prompt_budget.py fits the context to a token ceiling first, sacrificing the oldest conversation turns instead, and the hard constraints ride at the tail of the turn prompt where truncation cannot reach them.

Installation

Oracle-X runs locally on macOS, Windows or a Linux server.

Prerequisites

Requirement Minimum version Notes
Node.js v18.18.0 Next.js 15 minimum; CI builds on v20
Python v3.11 Matches CI
npm Latest Package management
Git Latest For cloning the repository
Ollama Latest Optional — only for LLM_PROVIDER=ollama; a cloud key works instead

Hardware note: qwen3.6:35b-a3b needs roughly 24 GB of free RAM/VRAM; qwen3.5:9b fits in about 7 GB. On Apple Silicon both run on the Metal backend out of the box. If you would rather not run a local model, set LLM_PROVIDER=groq:llama-3.3-70b-versatile (or any other supported provider) and skip Ollama entirely.

Scripted setup (recommended)

start.sh (macOS/Linux) and start.bat (Windows) provision the virtualenv, free ports 8000/3100, boot both servers, and seed the RAG index by POSTing /api/rag/initialize once the API is healthy.

# 1. Clone
git clone https://github.com/Yigtwxx/OracleX.git
cd OracleX

# 2. Configure
cp backend/.env.example backend/.env
cp frontend/.env.example frontend/.env.local
# → fill in your Supabase credentials (required)
# → pick an LLM provider: keep the Ollama default, or set LLM_PROVIDER + its API key

# 3. Only if running the model locally: pull it once
ollama pull qwen3.6:35b-a3b

# 4. Start
chmod +x start.sh
./start.sh

On Windows, skip the cp and chmod steps — start.bat copies the .env templates itself:

git clone https://github.com/Yigtwxx/OracleX.git
cd OracleX
ollama pull qwen3.6:35b-a3b
start.bat

Windows builds its own virtualenv at backend\venv-win\ so it never collides with the POSIX backend/venv/ that start.sh creates. Backend and frontend each open in their own console window; close them to stop the services.

The first run downloads a few gigabytes — sentence-transformers pulls torch — so give it ten minutes before deciding it has hung. Stay on Python 3.11 or 3.12: newer versions have no prebuilt hnswlib wheel for ChromaDB and the install then wants Microsoft C++ Build Tools to compile it.

Manual setup

1. Backend

cd backend

# start.sh expects this exact path
python3 -m venv venv
source venv/bin/activate        # Windows: venv\Scripts\activate

pip install -r requirements.txt
cp .env.example .env

uvicorn main:app --reload --host 0.0.0.0 --port 8000

Health check at http://localhost:8000/, Swagger UI at http://localhost:8000/docs, startup progress at /api/system/readiness.

2. Frontend

cd frontend

npm install
cp .env.example .env.local

npm run dev

The landing page is at http://localhost:3100; the terminal is at http://localhost:3100/home.

3. Seed the vector memory (optional, one time)

curl -X POST http://localhost:8000/api/rag/initialize

Running with Docker

The whole stack is containerized. One .env at the repository root configures both services.

Prerequisites: Docker Desktop (brew install --cask docker-desktop on macOS, then open /Applications/Docker.app once to grant permissions).

cp .env.example .env      # then fill in the Supabase values
docker compose up --build

Frontend at http://localhost:3100, backend at http://localhost:8000.

Development vs production

docker-compose.override.yml is loaded automatically and turns the stack into a development environment: source is bind-mounted, uvicorn runs with --reload, and the frontend runs next dev.

To run the production images instead — multi-stage builds, next start on a standalone bundle — skip the override explicitly:

docker compose -f docker-compose.yml up --build

Prebuilt images (GHCR)

Every push to main publishes both services to the GitHub Container Registry (.github/workflows/publish-packages.yml), so a server can pull instead of build:

docker pull ghcr.io/yigtwxx/oraclex-backend:latest
docker pull ghcr.io/yigtwxx/oraclex-frontend:latest

Tags: latest (tip of main), sha-<commit> for a pinned build, and <major>.<minor> / <version> on v* tags. Point the stack at them by setting image: in docker-compose.yml to the ghcr.io/... names and dropping the build: block — or just run the images directly.

The published frontend image has the localhost NEXT_PUBLIC_* values baked in, since they are inlined into the client bundle at build time. For a real domain, either build the frontend yourself (see below) or set the repository variables NEXT_PUBLIC_API_URL, NEXT_PUBLIC_WS_URL, NEXT_PUBLIC_SUPABASE_URL and NEXT_PUBLIC_SUPABASE_ANON_KEY so the workflow bakes those in instead. The backend image takes all of its configuration at runtime, so it needs no such treatment.

Ollama

If you use the local provider, Ollama runs on the host, not in a container: on Apple Silicon a containerized Ollama cannot reach the Metal GPU, which makes the default model unusably slow. The backend is preconfigured for http://host.docker.internal:11434, so once you ollama pull <model> on the host it connects. Until then the backend starts normally and only logs a warning — AI features fall through the chain or switch off. With a cloud provider configured, none of this applies.

Deploying to a server

docs/DEPLOY.md is the full guide — DNS, TLS through Caddy, the four settings that are wrong by default on a server, applying the migrations, and what to check afterwards. The rest of this section is the short version.

Three values change together, since the browser (not the container) resolves them:

Variable Local Server
NEXT_PUBLIC_API_URL http://localhost:8000 https://api.yourdomain.com
NEXT_PUBLIC_WS_URL ws://localhost:8000/ws/prices wss://api.yourdomain.com/ws/prices
CORS_ORIGINS http://localhost:3100 https://yourdomain.com

NEXT_PUBLIC_* values are baked into the client bundle at build time, so changing them requires a rebuild (docker compose build frontend), not just a restart.

Runtime state — Chroma vector stores, watchlists, analysis reports, liquidation history — lives in the backend-data named volume and survives docker compose down. Use docker compose down -v only when you intend to wipe it.

The backend runs a single uvicorn worker by design: the APScheduler jobs, the liquidation collector, the analysis job registry and the price-streaming service are per-process singletons, so scaling means running one container, not more workers.


Environment Configuration

Both sides ship a committed .env.example — copy it rather than guessing. Every variable has a working default except the Supabase credentials, which the backend validates at startup and refuses to boot without. Features whose key is missing simply switch off.

backend/.env

# ── Supabase (required — startup fails without these) ────────────────────────
SUPABASE_URL=https://your-project.supabase.co
SUPABASE_KEY=your-publishable-anon-key
# Service-role key bypasses RLS — keep it secret, backend only.
SUPABASE_SERVICE_ROLE_KEY=your-service-role-secret-key

# ── LLM provider ─────────────────────────────────────────────────────────────
# Format: <provider> or <provider>:<model>. Only the FIRST colon splits them,
# so Ollama tags survive: ollama:qwen3.6:35b-a3b
# Supported: ollama, groq, gemini, openai, anthropic, openrouter, deepseek,
#            together, mistral, xai, cerebras, fireworks, perplexity, custom
LLM_PROVIDER=ollama
LLM_FALLBACK_PROVIDERS=            # e.g. gemini:gemini-flash-latest,ollama
LLM_MODEL=qwen3.6:35b-a3b          # used when a chain entry omits ":<model>"
LLM_MAX_RETRIES=3
LLM_RATE_LIMIT_MAX_WAIT=30         # 60 rides out a free-tier per-minute quota
LLM_RATE_LIMIT_COOLDOWN=60
LLM_DAILY_QUOTA_COOLDOWN=1800
LLM_NUM_CTX=32768                  # what the server is asked for
# The real ceiling: the prompt builder budgets against this, deliberately below
# the point where a local server silently truncates. See services/prompt_budget.py.
PROMPT_TOKEN_BUDGET=12000

# Encrypts per-user API keys before they reach Supabase. Empty disables the
# BYO-key feature entirely — a key is never stored in plaintext.
#   python -c "from cryptography.fernet import Fernet; print(Fernet.generate_key().decode())"
LLM_KEY_ENCRYPTION_SECRET=

# Only for LLM_PROVIDER=custom (self-hosted vLLM / LM Studio / LiteLLM proxy).
LLM_BASE_URL=
LLM_API_KEY=

# ── Local LLM (Ollama) ───────────────────────────────────────────────────────
OLLAMA_BASE_URL=http://localhost:11434
OLLAMA_KEEP_ALIVE=30m              # "-1" pins the model until the daemon stops

# ── Provider API keys — fill in only the one(s) you use ──────────────────────
GROQ_API_KEY=
GEMINI_API_KEY=
OPENAI_API_KEY=
ANTHROPIC_API_KEY=
OPENROUTER_API_KEY=
DEEPSEEK_API_KEY=
TOGETHER_API_KEY=
MISTRAL_API_KEY=
XAI_API_KEY=
CEREBRAS_API_KEY=
FIREWORKS_API_KEY=
PERPLEXITY_API_KEY=

# ── Optional external API keys ───────────────────────────────────────────────
ETHERSCAN_API_KEY=          # on-chain exchange flows; empty disables the feature

# Aggregated open interest for the derivatives board. Empty is fine: it falls
# back to the Binance/OKX/Bybit endpoints, shows ~30 days instead of the full
# daily series, and labels itself accordingly.
COINALYZE_API_KEY=

# ── BIST & TEFAS ─────────────────────────────────────────────────────────────
# TEFAS, KAP, Takasbank and Borsa İstanbul need no key at all. This one is the
# Turkish central bank's statistics service (EVDS), and it buys exactly one
# thing: the CPI *series*, so a real return can be computed over any window
# rather than only over the trailing year. Without it the realm still reads the
# current inflation rate, policy rate and exchange rate from the same scanner
# the equity board uses.
#
# The degradation is one-directional on purpose — a window with no deflator
# reports its nominal figure and says the real one is unavailable. It never
# borrows a nearby inflation number, because a real return computed against the
# wrong window is a specific wrong answer rather than a missing one.
TCMB_EVDS_API_KEY=

# ── Market data ──────────────────────────────────────────────────────────────
# CCXT exchange id for the live price socket. Binance is blocked in several
# countries and fails on load_markets(); any CCXT Pro venue with watch_tickers
# works — okx, bybit, kucoin, coinbase, kraken…
STREAM_EXCHANGE=okx

# ── Feature flags ────────────────────────────────────────────────────────────
USE_REAL_API=true
USE_AI=true                 # master switch for AI, whichever provider is set

# ── Chat pipeline ────────────────────────────────────────────────────────────
# Whether the model picks a turn's tools from an intent-filtered catalogue.
# Measure before turning this off again: python evals/eval_planner.py
CHAT_PLANNER_ENABLED=true
# A second, bounded look at whether the gathered evidence answers the question,
# and one chance to fix it. Separate flag on purpose — revertible independently.
CHAT_REFLECTION_ENABLED=true
# Lets the scrape ladder launch a browser for the few hosts that render entirely
# client-side. Safe to leave on with no browser installed: startup records a
# degraded health entry and the ladder reports the gap instead of failing.
# One-time install: `scrapling install`.
SCRAPLING_ALLOW_BROWSER=true
# Per-turn page-reading quotas. The browser quota stays at 1 deliberately — a
# launch costs 6-15s, which is a fifth of a turn spent on one class of evidence.
CHAT_MAX_SCRAPES_PER_TURN=3
CHAT_MAX_BROWSER_PER_TURN=1

# ── Alarm mail notifications ─────────────────────────────────────────────────
# Off by default. Leave SMTP_HOST empty and the whole panel stays hidden in the
# Alarm Centre — the toast, the sound and the OS notification all still fire.
# Any SMTP server works; Gmail needs an *app password*, not the account one.
SMTP_HOST=
SMTP_PORT=587
SMTP_USER=
SMTP_PASSWORD=
# Implicit TLS from the first byte (port 465). Leave false for 587 + STARTTLS.
SMTP_SSL=false
SMTP_STARTTLS=true
SMTP_TIMEOUT=20

# Leave SMTP_FROM empty to send as SMTP_USER. That is almost always right, and
# it is what keeps mail out of the spam folder: SPF and DKIM authenticate the
# From domain, and Gmail's relay rewrites a From that is not the authenticated
# account or a verified alias.
SMTP_FROM=
SMTP_FROM_NAME=Oracle-X
SMTP_REPLY_TO=

# Signs the token a browser gets after confirming its address, and which
# POST /api/alarms/email/notify requires — without it that endpoint would be an
# open relay. One is generated and persisted if you leave this empty, so an
# admin can turn the whole feature on from the panel.
#   python -c "import secrets; print(secrets.token_urlsafe(48))"
ALARM_EMAIL_SECRET=

ALARM_EMAIL_CODE_TTL_SECONDS=600
ALARM_EMAIL_CODE_MAX_ATTEMPTS=5
# Ceiling on notifications one confirmed address receives per hour. The failure
# this bounds is a too-loose alarm on a busy feed mailing someone until their
# provider stops trusting the sender.
ALARM_EMAIL_HOURLY_LIMIT=30

# Where the "open the terminal" button in an alarm mail points. Empty falls back
# to the first entry in CORS_ORIGINS.
APP_PUBLIC_URL=

# ── Admin ────────────────────────────────────────────────────────────────────
# Comma-separated emails that get /admin, matched against the verified email on
# the caller's JWT. Empty means nobody: adminship is never granted from the
# database, on the reasoning that a request can write the database and cannot
# write the environment.
ADMIN_EMAILS=

# ── Prediction markets ───────────────────────────────────────────────────────
# No key: all three Polymarket hosts are public for reads. The URLs exist only
# so a deployment behind a mirror can redirect them.
POLYMARKET_ENABLED=true            # false hides the board and its routes
POLYMARKET_GAMMA_URL=https://gamma-api.polymarket.com
POLYMARKET_CLOB_URL=https://clob.polymarket.com
POLYMARKET_DATA_URL=https://data-api.polymarket.com
POLYMARKET_BOARD_LIMIT=60
# The floors below which a bet analysis refuses rather than guessing, and the
# lower tier that still answers but caps its own confidence. Raising these makes
# the terminal quieter and more honest; lowering them does the reverse.
POLYMARKET_MIN_SOURCES=4
POLYMARKET_MIN_DOMAINS=3
POLYMARKET_MIN_BODY_CHARS=1200
POLYMARKET_MIN_QUERIES_ANSWERED=2
POLYMARKET_DEGRADED_MIN_SOURCES=3
POLYMARKET_DEGRADED_MIN_DOMAINS=2
POLYMARKET_DEGRADED_MIN_BODY_CHARS=600
POLYMARKET_DEGRADED_MAX_CONFIDENCE=0.45

# ── CORS (comma-separated allowed frontend origins) ──────────────────────────
CORS_ORIGINS=http://localhost:3100,http://127.0.0.1:3100

# ── Background scheduler intervals (minutes) ─────────────────────────────────
NEWS_FETCH_INTERVAL_MINUTES=2
RAG_INDEX_INTERVAL_MINUTES=30

# ── Logging (DEBUG | INFO | WARNING | ERROR) ─────────────────────────────────
LOG_LEVEL=INFO

RAG retrieval tuning (RAG_MIN_RELEVANCE, recency half-lives, importance weights, outcome horizons) all have measured defaults in config.py and are documented, commented out, in backend/.env.example. Re-measure the relevance floor against your own store rather than guessing at it:

cd backend && ./venv/bin/python ../scripts/calibrate_rag_relevance.py

frontend/.env.local

NEXT_PUBLIC_API_URL=http://localhost:8000
NEXT_PUBLIC_WS_URL=ws://localhost:8000/ws/prices

# Client-side auth — publishable/anon key only, never the service-role key.
NEXT_PUBLIC_SUPABASE_URL=https://your-project.supabase.co
NEXT_PUBLIC_SUPABASE_ANON_KEY=your-publishable-anon-key

# Public origin this deployment is reached at. Only the link preview card needs
# it: metadataBase resolves the generated opengraph-image to an absolute URL,
# and a scraper cannot fetch a relative one.
NEXT_PUBLIC_SITE_URL=http://localhost:3100

Supabase schema

Apply the migrations in supabase/migrations/ in order, from 001_initial_schema.sql through 015_llm_settings_notes.sql, via the Supabase SQL editor or CLI. Without them, auth-gated pages (chat history, community, profile, ownership, per-user AI settings) will render but fail to persist.

Nothing records which files have run, so afterwards confirm the schema is actually live rather than assuming it:

cd backend && python scripts/verify_migrations.py

It reads every migration, works out which tables they should leave behind (accounting for the renames and drops later files perform), and asks the project. Exit code 1 means a table is missing.

Degradation matrix

Missing Consequence
No reachable LLM provider No AI sentiment, research notes, market reports or Oracle chat. Market data, charts and heatmaps unaffected.
Supabase credentials Backend refuses to start — these are validated at boot.
LLM_KEY_ENCRYPTION_SECRET Per-user BYO-key feature is disabled; the server-side provider chain still works.
ETHERSCAN_API_KEY On-chain whale and exchange-flow widgets go empty.
No browser for Scrapling Client-rendered pages (TradingView) are unreadable; the ladder names the gap and startup records a degraded health entry. Every other host is unaffected.
A chain RPC endpoint down That one row on /chains reports error; the other seven report normally and the board does not 503.
Coin Metrics unreachable The exchange-flow strip empties and anomaly detection falls back to its own rolling baseline.
SMTP_HOST unset Alarm mail is off and the Alarm Centre hides its email panel. The toast, the sound and the OS notification are unaffected — mail is the fourth channel, not the only one.
Polymarket unreachable /polymarket answers 503 rather than an empty board, and the elections panel drops its odds column and says so.
Thin evidence for a bet analysis A named insufficient_evidence refusal listing the searches that came back empty. This is a successful run: the measured facts and microstructure above it are unaffected.
Wikipedia unreachable The elections board serves its cached calendar for up to a week, then 503s — an empty board would claim no election is scheduled anywhere.
TCMB_EVDS_API_KEY unset The BIST realm still deflates the trailing year from the scanner's own inflation reading; longer windows report their nominal figure and say the real one is unavailable. No inflation number is ever borrowed from a neighbouring window.
TEFAS, KAP or the BIST quote source unreachable Only the BIST realm is affected, one board at a time, and the health badge marks BIST & TEFAS degraded. The global realm shares no upstream with it.
Takasbank's parameter file missing /api/bist/viop-map/{ticker} walks back through a lookback window and renders the last published figure with its date on the screen; past that it 503s. The distance a band sits at is a published number and the endpoint will not substitute one.
Yahoo intraday history unavailable The VİOP map loses its spot volume-profile layer and still answers. The two layers fail unequally on purpose: one is measured, the other is published.
Resmî Gazete unreachable The Gece Mesaisi badge renders an unavailable state. The endpoint cannot fail, because it sits in the chrome of every BIST page.
Upstream market API down Last good cached payload is served (stale fallback) instead of an error.

API Reference

Oracle-X is a headless data provider as well as a terminal: bots and scripts can use the FastAPI endpoints directly without opening the UI. All payloads return application/json; user-scoped routes require a Supabase bearer token.

Market data

Endpoint Method Response payload and logic
/api/market-overview GET Global crypto market cap, dominance and top movers from CoinGecko's /global and /coins/markets.
/api/nasdaq-overview GET Live cached metrics for the "Magnificent 7" and core equities.
/api/market/indices GET Traditional index snapshots.
/api/asset-detail/{symbol} GET Resolver combining CoinGecko ID mapping and Yahoo Finance quoteSummary. Returns 30+ fields.
/api/price/{symbol} GET Single spot price, crypto or equity, resolved server-side.
/api/market/candles/{symbol} GET OHLCV series from OKX.
/api/heatmap/data GET Nested JSON structured for treemap consumption — price change, volume, social hype, dev activity.
/api/fear-greed GET Integer index (0-100) plus sentiment categorization.
/api/technical/{symbol} GET Multi-timeframe read (4h/1d/1w, or 1h/1d/1w for equities): per-horizon RSI, ATR and trend, clustered support/resistance zones with touch counts and strength, swing structure and alignment. Timeframes with too little history are named in coverage rather than faked.

News and AI

Endpoint Method Response payload and logic
/api/news GET Articles scored bullish/bearish/neutral with confidence and LLM-extracted tickers.
/api/news/{news_id} GET A single article by id.
/api/news/{news_id}/analysis/jobs POST Starts the staged per-article research note; joins an in-flight run for the same article.
/api/news/analysis/jobs/{job_id} GET Polls that job for its stage, partial result and final verdict.
/api/news/{news_id}/analysis GET The cached analysis, if one exists for the current pipeline version.
/api/analyze POST Runs a single article through the LLM and RAG v1 outcome memory.
/api/symbols GET Currently tracked symbol universe.
/api/llm/status GET Active provider/model, the resolved fallback chain, skipped entries and why. ?include_models=true lists what each provider currently offers. Keys are never returned.
/api/analysis/reports GET Freshness of the stored daily/weekly/monthly reports. Never generates.
/api/analysis/report/{timeframe} GET The stored market report, or an empty one if it has not been generated yet.
/api/analysis/jobs/{timeframe} POST Starts the four-stage report pipeline in the background; joins an in-flight run for the same timeframe.
/api/analysis/jobs/{job_id} GET Polls a running report job for its stage, and its result once finished.

RAG and agents

Endpoint Method Response payload and logic
/api/rag/initialize POST Seeds the v2 store with historical news, events and prices.
/api/rag/stats GET Collection counts and index health.
/api/rag/query GET Semantic search across the temporal memory, composite-scored.
/api/rag/news-similarity POST Nearest historical precedents for a supplied headline.
/api/rag/event-at-date GET What the store knows happened on a given date.
/api/rag/insights/{symbol} GET v3 insights agent — why an asset moved.
/api/rag/compare/{a}/{b} GET v4 reasoning agent — two-asset comparison.
/api/rag/scenario POST v4 what-if scenario simulation.
/api/rag/daily-brief GET v5 proactive agent — morning brief.
/api/rag/anomalies GET v5 price-vs-news divergence detection.
/api/chat POST Oracle chat agent — intent classification, tool plan, evidence, reflection, answer.
/api/chat/jobs POST Runs the same turn out of the request path; GET /api/chat/jobs/{id} polls it and DELETE cancels it.
/api/chat/status GET Whether the chat agent is available, and which provider is serving it.

Derivatives, exchanges and real-time

Endpoint Method Response payload and logic
/api/liquidations/heatmap GET Aggregated realised-liquidation clusters from the OKX WS collector.
/api/liquidations/map/{symbol} GET Modelled liquidation map — where leveraged positions would be force-closed.
/api/liquidations/levels/{symbol} GET Per-symbol liquidation levels.
/api/liquidations/history/{symbol} GET Rolling 24h realised-liquidation history.
/api/liquidations/lines/{symbol} GET The modelled book over time — where clusters formed and how long they survived.
/api/liquidations/profile/{symbol} GET The standing book against price rather than time, binned and tiered, with spot's own bin marked.
/api/derivatives/open-interest/{symbol} GET Open interest against price per venue — the input the three liquidation views model from. Carries the aggregate change and the OI-to-market-cap ratio.
/api/derivatives/dex-perps GET On-chain perpetual venues in three independent rankings, each naming its own provider. Never joined into one table.
/api/home/funding-rates GET Perpetual funding rates across major pairs.
/api/home/onchain GET Whale transfers and exchange in/outflows.
/api/home/asset-brief/{symbol} GET One followed asset's card: price, sparkline series, the liquidity ladder around spot and a grounded sentence.
/api/macro/board GET Indices, commodities, currencies and the macro calendar in one payload.
/api/macro/regime GET The risk-on / risk-off / neutral label, its three component votes, and the model's sentence explaining them.
/api/macro/pizza-index GET Pentagon Pizza Index reading, its per-venue baselines, and the source's own figures for cross-checking.
/api/macro/neh-index GET Nothing Ever Happens index — the highest probability in a basket of tracked geopolitical markets, recomputed here from the source's raw figures.
/api/macro/elections GET Upcoming national elections with Polymarket odds joined where a market matches confidently. Carries odds_available and odds_cap so missing odds read as coverage, not as absence.
/api/chains/board GET All eight chains: height, cadence, load, priced fees, economics and recent blocks, plus the daily exchange-flow strip. A chain that could not be read carries error on its own row.
/api/chains/anomalies GET What on the board is not normal, each flag with a Python-written sentence, plus an hourly model note explaining why they co-occur.
/api/exchanges GET CCXT-supported exchange registry.
/api/arbitrage/{base}/{quote} GET Cross-exchange spread for a pair; /api/arbitrage/scan sweeps the board.
/ws/prices WS Live price stream — snapshot on connect, then price_update frames.

Prediction markets

Endpoint Method Response payload and logic
/api/polymarket/board GET The highest-volume open markets with prices, drift, volume and category. 503 rather than an empty board when the upstream is unreachable.
/api/polymarket/map GET The three geographic layers, each carrying its own provenance. They are never merged, because only one of them is measured.
/api/polymarket/markets/{slug} GET Model-free facts for one market: outcome prices, drift, liquidity, spread, holder concentration, microstructure notes, and the dated windows in which it re-priced. 404 for an unresolvable slug.
/api/polymarket/markets/{slug}/analysis/jobs POST Starts the bet analysis; joins an in-flight run for the same market. GET /api/polymarket/analysis/jobs/{job_id} polls it. May finish as an explicit insufficient_evidence refusal.
/api/polymarket/markets/{slug}/origin/jobs POST Starts the origin trace — why the bet was opened — as a separate job that never feeds the analysis. GET /api/polymarket/origin/jobs/{job_id} polls it.

Borsa İstanbul

The Turkish realm's surface, all under /api/bist. Every return in these payloads carries its deflated counterpart beside the nominal one, and every board names the upstream it could not reach rather than serving a shorter list.

Endpoint Method Response payload and logic
/api/bist/overview GET The realm's landing board: indices, derived sector heat, breadth and the macro strip in one payload.
/api/bist/stocks GET The equity screener — one scanner request covers the whole listing, with each company's one-year return in three frames (nominal, TÜFE-deflated, USD).
/api/bist/stocks/{ticker} GET One company: quote, fundamentals, index membership and a price history. Costs nothing the screener has not already paid for.
/api/bist/heatmap GET One index as a treemap — area is market capitalisation, colour is the reader's chosen metric, and VİOP open interest rides along where a contract exists.
/api/bist/market-note GET What the equity board says as a set — whether the index and the breadth agree, which no row can show.
/api/bist/funds GET The TEFAS screener: every fund the platform lists with its period returns. /funds/compare puts several on one axis.
/api/bist/funds/{code} GET One fund's NAV history and the risk statistics derived from it, computed against a TRY policy rate rather than against zero.
/api/bist/funds/{code}/holdings GET Which companies the fund owns, parsed from its monthly KAP portfolio report. Lazy, per fund, and written to refuse rather than guess.
/api/bist/funds/market-note GET The fund universe narrated — whether the median fund beat inflation, and how far apart the ends of the board are.
/api/bist/kap GET The disclosure tape, each row carrying a class and a materiality band computed in Python.
/api/bist/kap/{index}/note GET One filing explained — the only generated note in the codebase written over a primary source rather than over a board.
/api/bist/restrictions GET Exchange measures — circuit breakers, gross settlement, short-selling bans — filtered out of the same tape, since no feed of them exists on its own.
/api/bist/viop GET Futures and options with the open interest behind each contract: the one place in this market where positioning is published rather than inferred.
/api/bist/viop-note GET Whether the day's move was positions being opened or closed — the pairing of price and open interest, which neither column states alone.
/api/bist/viop-map/underlyings GET The single-stock futures universe, ranked by the newest session's turnover.
/api/bist/viop-map/{ticker} GET One underlying's positioning against Takasbank's published scan range, plus the observed spot volume profile. 503 without the bulletin or the parameter — the distance is a published number and this endpoint will not substitute one.
/api/bist/positioning GET Free float, unusual volume, position in the 52-week range and futures open interest. /positioning-note narrates what they say together.
/api/bist/macro GET Inflation, the policy rate and the exchange rate, plus the deflators the rest of the realm measures against. Answers with no key configured.
/api/bist/calendar GET Results announcements and ex-dividend dates, derived from the same scanner response the screener already paid for.
/api/bist/night-shift GET Gece Mesaisi Endeksi — how hard the state is legislating today, from the Resmî Gazete. Cannot fail: it answers unavailable rather than erroring, because it feeds a badge in every BIST page's chrome.

Alarms

Alarms themselves live in the browser; these routes exist only because a browser cannot send mail.

Endpoint Method Response payload and logic
/api/alarms/email/status GET Whether outbound alarm mail is configured at all.
/api/alarms/email/request-code POST Sends a confirmation code, after an MX and disposable-domain check. Rate-limited.
/api/alarms/email/confirm POST Exchanges the code for an HMAC token bound to that address.
/api/alarms/email/notify POST Sends one alarm mail. Requires the token, dedupes by address and event, and caps deliveries per address per hour. 403 tells the browser to forget the address.
/api/alarms/email/smtp GET/PUT/DELETE Admin-scoped relay settings, stored encrypted outside the environment. The password is never returned — only whether one is set. POST /api/alarms/email/smtp/test sends a probe and passes the relay's real error through.

User, social and system

Endpoint Method Response payload and logic
/api/system/readiness GET Startup progress for the boot gate — per-step state, ready, degraded, blocked. No I/O.
/api/system/health GET The eleven upstream categories and what each last did. Passive — the HTTP helpers report what they already ran, so this is cheap enough for the frontend's ten-second poll.
/api/home/watchlist GET/POST/DELETE Watchlist CRUD with live prices merged in.
/api/analysis/notes GET/POST/DELETE Personal research notes.
/api/profile GET/PUT Profile, subscription, connected accounts, settings. Identity comes from the token.
/api/profile/llm GET/PUT/DELETE Per-user provider, model and encrypted API key. POST /api/profile/llm/test validates a key before saving.
/api/community/posts GET/POST Community feed; nested comment and like routes below it.
/api/social/* GET/POST Sentiment, follows and public profiles.
/api/ownership/* GET Institutional holdings boards, per-entity detail, consensus, watchlist overlap and historical snapshots.
/api/ownership/flow-note GET Last quarter's tracked-institution moves in prose, counted from filed 13F activity only.
/api/admin/* GET/POST Moderation actions and the audit log. Admin-scoped.

Example request

import httpx

# Fetch detailed NVIDIA fundamentals from a local instance
r = httpx.get("http://localhost:8000/api/asset-detail/NVDA")
data = r.json()

print(f"Forward P/E: {data['forward_pe']}")
print(f"Target High: {data['target_high_price']}")
print(f"Analyst Rec: {data['recommendation']}")

Claude Code plugin

The skills and the MCP server also ship as three Claude Code plugins, declared in .claude-plugin/marketplace.json. This is the shortest install: one command adds the marketplace, and each plugin brings its skill, its slash commands, three subagents and — for oracle-x — the MCP server, with no virtualenv to create by hand.

claude plugin marketplace add Yigtwxx/OracleX
claude plugin install oracle-x@oracle-x         # MCP tools, API skill, /levels /brief /health
claude plugin install oracle-x-bist@oracle-x    # Borsa İstanbul, /bist /viop
claude plugin install oracle-x-dev@oracle-x     # working on this codebase

The entries point at agent-skill/ rather than copying it, so there is one copy of each skill in the repository.

Two of the plugins also carry hooks. oracle-x probes /api/system/health at session start, so a stopped backend is a known fact rather than 36 tools failing one by one three turns later. oracle-x-dev turns four of this repo's documented traps into decisions a command has to get past — git add -A over the generated files under backend/data/, ruff run from the root where it misses line-length = 100, pytest outside backend/, and a production build while the dev server holds frontend/.next/. Both check they are in the right place first and are inert everywhere else.

plugins/README.md holds the format's sharp edges — the ones that pass claude plugin validate and still refuse to load, including why the subagents live at the repository root rather than beside the commands.

MCP server

mcp-server/ exposes the same instance to any MCP client as 36 tools, and it is the one to install first. A tool list is already in the model's context, so the only decision left is which tool to call:

cd mcp-server && python3.11 -m venv .venv && .venv/bin/pip install -e .
claude mcp add oracle-x -e ORACLE_X_URL=http://localhost:8000 \
  -- "$PWD/.venv/bin/python" -m oracle_x_mcp

Tools summarize where the raw payload is a rendering artifact: the liquidation map answers with ~8,000 heatmap cells (214 KB), and the tool returns the largest clusters per side anchored to spot in 1.1 KB.

Agent skills

Three AgentSkills live under agent-skill/, so a coding agent — Claude Code, OpenClaw, or anything else that reads the specification — can work with Oracle-X without a bespoke integration:

npx skills add Yigtwxx/OracleX --skill oracle-x-api     # crypto, US equities, macro
npx skills add Yigtwxx/OracleX --skill oracle-x-bist    # Borsa İstanbul
npx skills add Yigtwxx/OracleX --skill oracle-x-dev     # work on this codebase
export ORACLE_X_URL=http://localhost:8000

The market split is on purpose: BIST is 32 endpoints and most installs are not in Turkey, so an agent that will never ask about TEFAS or VİOP should not carry them in context on every question. oracle-x-bist is also the one that works before there is a server — how a lira return becomes a real one, and where Takasbank actually publishes the scan range, are facts about the market rather than about any instance.

They sit beside the MCP server rather than replacing it, because a skill has to be consulted and measurement showed oracle-x-api triggering on almost nothing — a model asked "what is BTC doing" answers from its own knowledge instead of going to look. Ask for it by name, or install it for writing code against the API, where an agent reaches for documentation anyway. agent-skill/README.md carries the measurement.

SKILL.md is hand-written and carries the part no generator can produce: which endpoint answers which question, and the rules that keep an agent from inventing a number the terminal declined to give it. The endpoint reference beside it is generated from this app's own OpenAPI schema, and CI fails if the committed copy has drifted from the routes:

python scripts/build_agent_skill.py --check

Quality Gates

CI (.github/workflows/ci.yml) runs on every push and pull request to main, in five jobs:

Job Steps
Backend (Python 3.11) ruff check . → ruff format --check . → python -m compileall → pytest
Frontend (Node 22) npm ci → npm run lint → npm run format:check → npm run typecheck → npm test → npm run build
Frontend browser tests npx playwright install --with-deps chromium → npm run build → npm run e2e
Generated files python scripts/build_agent_skill.py --check → python scripts/build_repo_facts.py --check
MCP server ruff check . → ruff format --check . → pytest

The backend suite is 149 pytest modules, roughly 3,200 tests covering the LLM chain and rate-limit behaviour, per-user settings and key encryption, auth enforcement, prompt rendering, RAG scoring and outcomes, symbol detection, news attribution, the analysis pipelines, chat intent/focus/memory/budget, the chain adapters and their anomaly detection, the technical zone builder, the Polymarket boundary and its sufficiency gate, the elections registry, alarm mail, and the BIST realm end to end — the TEFAS and scanner shape adapters, the KAP tape and its materiality classes, Turkish text folding, the real-return frames, the VİOP bulletin parser and the margin map, with the Takasbank SPAN archive and the bulletin CSV committed as fixtures so none of it reaches the network. requirements-dev.txt deliberately excludes torch and chromadb so CI installs only what the tests import.

The counts here are rounded on purpose. Exact figures live in frontend/lib/generated/repo-facts.ts, measured by the collectors rather than counted by eye, and the --check gate below fails the build when one stops being true — which is how this file came to claim 1,634 backend tests long after there were more.

A second workflow (.github/workflows/publish-packages.yml) is delivery, not a gate: after a push to main — or a v* tag — it builds both Dockerfiles and pushes them to ghcr.io. It never blocks a pull request.

The generated-files job rebuilds two artefacts and fails if either differs from the committed copy. The first is the agent skill's endpoint reference, taken from the app's OpenAPI schema: a route rename that ships an unchanged skill produces a document describing paths the API no longer serves, and an agent reading it cannot tell that apart from missing data. The second is repo-facts.ts, the numbers the /developers and /faq pages state about this repository. Hand-maintained they were wrong within a release and stayed wrong — three documents claimed 26 MCP tools long after there were 30, and the frontend suite was reported 70 tests short because someone had counted it( and never saw the parametrised tables. They now come from the collectors: pytest --collect-only and vitest list for the suites, an AST walk for the MCP tools, the imported CATEGORIES and PRESETS for health and providers.

The frontend suite is 54 vitest modules, roughly 1,000 tests, concentrated on the pure logic where a failure would be silent rather than loud — the scroll canvas stage schedule, the seeded candle series, the note anchors, the alarm predicates, the market-breadth derivations, the derivatives board's binning and venue shares, the two realms' tab sets, and the formatting rules shared between panels (chain-format, technical-format, ai-note, pizza-index, polymarket-format, and the nine bist-* modules). Components are deliberately not tested; anything with a branch in it is expected to live in lib/. lib/marketing/ is tested for one extra rule: the prose carries no digits, so every figure on a marketing page has to come from the generated facts.

What neither suite can see is the chain between them — a router reading the URL, a hook fetching, a component rendering, a click lifting state into the page — and that is what frontend/e2e/ covers, in a real Chromium driven by Playwright. Every upstream is answered by route stubs inside the browser (e2e/stubs.ts): the backend cannot start without a Supabase project, so a suite that needed one would never run in CI, and its contract is already pytest's job. The stubs answer 404 for anything a test did not ask for, on the principle that the app is built to survive a missing upstream but not a well-formed lie. Three flows are pinned so far: sign-in through supabase-js into the profile page, the 24h change histogram filtering the overview table, and the realm switcher reading its realm off the path.

.pre-commit-config.yaml wires the same tools locally:

pip install pre-commit && pre-commit install
pre-commit run --all-files

Evals

Two behaviours are measured rather than asserted, because both fail by degrees and neither has a right answer a unit test could pin down. They hit a live provider, so they are run by hand and not in CI:

cd backend
python evals/eval_planner.py    # tool-selection recall and precision
python evals/eval_refusal.py    # how often chat declines a question it could answer

CHAT_PLANNER_ENABLED and the conceptual answer mode are both on because of numbers these produced. Re-measure before reverting either.

Schema drift

Migrations are applied by hand and nothing records which files have run, so the presence of a file in supabase/migrations/ is not evidence its schema is live — and the failure is quiet: the backend boots, the page renders, only the write fails.

cd backend && python scripts/verify_migrations.py

Roadmap

Shipped in v1.0.0:

  • Dark-mode terminal layout, component system, App Router routing.
  • Real-time market data (CoinGecko, Yahoo Finance quoteSummary, OKX) with a TTL caching layer and stale fallback.
  • Semantic news pipeline, asset detail views and heatmap algorithms.
  • Supabase Auth with application-layer authorization — profiles, community feed, chat history.
  • ChromaDB RAG v2 temporal store, the v3/v4/v5 agent layer, and the Oracle chat agent with web-search augmentation.
  • Provider-agnostic LLM layer with fallback chains and rate-limit handling, per-user BYO keys encrypted at rest, file-backed prompts, staged report/news pipelines with job polling, calibrated RAG scoring with multi-horizon outcomes, and the startup boot gate.
  • Institutional ownership tracking, macro dashboard, live events, social sentiment and admin moderation with audit logging.

Shipped in v1.1.0:

  • Public landing page on a scroll-driven canvas; the terminal moves into an (app) route group.

Shipped in v1.2.0 – v1.3.0:

  • Chain telemetry board — eight networks on /chains through four adapter families, comparable fees, per-row failure isolation, a diurnally-corrected rolling baseline and Python-computed anomaly detection, with Coin Metrics exchange flows for BTC and ETH.
  • Chat pipeline rebuild — intent classification, cross-turn focus, model-chosen tools from an intent-filtered catalogue, a bounded reflection round, cross-session memory (migration 014_chat_memory), and a scrape ladder that can finally read charts, social posts and table-shaped pages. Both new behaviours ship behind their own flags, with evals attached.
  • Multi-timeframe technical analysis — three horizons per asset, support and resistance as clustered zones with touch counts and strength scores instead of drifting decimals.
  • Grounded notes — one engine writing the commentary on the macro, chain and ownership boards, fingerprint-cached on the facts it was given, never doing arithmetic.
  • Macro regime read and the Pentagon Pizza Index badge.
  • Rendered OpenGraph link-preview card, and scripts/verify_migrations.py for checking that the repo's migrations are actually live.

Shipped in v1.4.0:

  • Prediction markets — the /polymarket board, model-free market facts, sharp moves measured in probability points, an origin trace, a three-layer map that refuses to invent trader geography, and a bet analysis gated by evidence floors that is allowed to refuse rather than guess.
  • Elections board — a worldwide calendar parsed from Wikipedia, joined to Polymarket odds behind a two-tier confidence gate, with the calendar and the odds failing independently.
  • Alarm Centre — twelve watchable sources under four condition kinds, evaluated client-side with hysteresis and dedupe, delivered as a toast, a sound, an OS notification and optionally mail through an SMTP relay that confirms an address before it will send to it.
  • Market internals — advance/decline breadth, a fixed-bucket change histogram that filters the table above it, and a divergence board, all derived from the payload the overview already holds.
  • Nothing Ever Happens index beside the Pentagon Pizza gauge.
  • Generated repository facts — /developers and /faq, and the numbers on them measured by collectors and gated in CI, so a figure that stops being true fails the build instead of quietly ageing.
  • Borsa İstanbul realm — a second terminal on the same shell, in Turkish, behind a realm switcher that reads its state off the path: the equity screener and heatmap off one scanner request, the TEFAS fund board with holdings parsed out of monthly KAP portfolio PDFs, the KAP tape with materiality classified in Python and one filing explained by the model, VİOP read twice (an in-session scrape and the exchange's own end-of-day bulletin), positioning, and the Turkish macro backdrop. Every return is served with its TÜFE- and USD-deflated counterpart, because a lira figure alone answers a question nobody asked.
  • VİOP margin map — the crypto liquidation map with its invented leverage distribution replaced by Takasbank's published Price Scan Range, drawn beside an observed spot volume profile, and labelled as a scan range rather than a margin-call level because VİOP publishes no maintenance rate.
  • Gece Mesaisi Endeksi — the realm's counterpart to the Pentagon Pizza Index, read off the Resmî Gazete, on an endpoint that cannot take the chrome down with it.
  • Derivatives board — open interest against price, the standing liquidation book drawn against price rather than time, historical lines, and on-chain perpetual venues as three rankings that are never joined.
  • Home rebuilt around what the reader follows — three chosen slots with a liquidity ladder and a grounded sentence each, over a one-line market ribbon, in place of a screen of market-wide on-chain cards.
  • /borsa — a fourth public page, a light Turkish document that reads live figures, where the other three render with the backend down.
  • Three AgentSkills instead of two — Borsa İstanbul split out of the API skill, because it was a third of the allowlist and most installs are not in Turkey. It is the first skill here that is useful without an instance: how a lira return becomes a real one, and where Takasbank actually publishes the scan range, are facts about the market rather than about any server.
  • Claude Code plugins — the same three skills and the MCP server behind claude plugin marketplace add, with slash commands, and no virtualenv to create by hand.
  • Six VİOP and BIST MCP tools — the Turkish surface had a skill and no tools, which made the least-covered market the one a model would never consult unprompted.

Shipped in v1.5.0:

  • Three subagents — two analysts that keep twenty payloads out of the conversation that dispatched them, and a reviewer for the conventions CI cannot check.
  • Plugin hooks — a session-start probe so a stopped backend is a known fact rather than 36 tools failing one at a time, and a Bash guard that turns four traps this repository could previously only describe into decisions a command has to get past.

Shipped in v1.6.0:

  • Bring your own keys, all the way through — a reader's own LLM key already went at the head of the chain, but the status route reported on the server's chain alone, so on an install with no server key the one person who could have chatted was the one the feature exists for. Data provider keys (EVDS, Coinalyze) now work the same way, per reader and per request, and a board without one renders with a notice rather than an empty panel.
  • A reader's own Ollama — the endpoint is theirs to name, because the free local model runs on their machine and not on the server. Only the self-hosted presets accept one, and only an address the public internet can reach: every resolved address is checked, so a hostname pointing at 10.x is refused rather than dialled.
  • Usage that is measured rather than asserted — one row per model call, with the feature, the provider, the tokens each provider already returned and thrown away, and who paid. Scheduled work is recorded with no user, which is what makes "what does this box spend" answerable at all: on a self-hosted install the two-minute news scan is most of it.
  • A front door — Caddy, automatic certificates, one origin for the app and the API, and a Compose overlay that removes the published ports it is there to sit in front of. With docs/DEPLOY.md for the settings whose defaults are wrong on a server and right on a laptop.

Shipped in v1.6.1:

  • Track record — /track-record, public and unauthenticated, scoring every directional call the news pipeline has made against what the price actually did. The premise of the earlier plan was wrong: nothing was being recorded. record_outcome() and pending_outcomes() had no callers and every stored verdict carried a null outcome, so the loop had to be built before it could be served. Two append-only tables, because a verdict's one-day horizon is measurable tomorrow and its one-year horizon is not — held in a single row that would mean rewriting the record five times as the horizons arrive. An earlier plan committed these to a Sepolia contract, which was dropped: a testnet proves nothing about tamper-resistance, and a real chain would mean paying for every write.

    The horizons are measured from the verdict rather than the headline, so a
    move that happened while the analysis was still running cannot be credited
    to the call. Neutral verdicts are counted apart from directional ones,
    every rate is printed beside what the best fixed answer scored on the same
    calls, and a bucket below the sample floor shows its count and no rate.
    Building it surfaced a second bug: `okx_market` strips its venue prefix
    before calling OKX and the Yahoo path does not, so `NASDAQ:NWS` was a 404
    returned as "no history" — indistinguishable from an asset the venues
    genuinely do not carry. The curated event catalogue escaped it by writing
    plain tickers; the news pipeline does not, and this was the first caller
    to hand it those symbols.
    
  • Three unauthenticated holes closed — every background job shares one registry and the poll routes fetched by id alone, so a chat job id read through /api/analysis/jobs/{id} returned somebody else's question and the model's answer. The rule existed, on Job.owner_id, and was applied correctly in one router out of five; it lives in readable_job now, where a caller has to name the kind it expects. POST /api/rag/initialize had no dependency at all while re-embedding the whole corpus, and next was two versions behind an unauthenticated RCE through the image optimizer — an endpoint this app has no use for and had not turned off.

  • Boards that say when they are broken — the overview never read isError from any of its queries, so a failed fetch drew six blank panels: an empty table, a breadth strip reading zero, a distribution with no bars. On a markets page that is a claim about the market. The RAG stats route had the same shape, answering news_count: 0 for a store it could not reach — to an agent instructed to call it exactly when results look thin.

  • Prices that arrive when the socket opens — the server has always sent a snapshot on connect and the client parsed it and threw it away, so the board sat on REST prices until the first per-symbol tick. Its keys are why: the snapshot carries the exchange's own BTC/USDT and updates carry BTCUSDT, and there were four spellings of that normalisation across three files, two of them in different orders.

  • A holdings board that refreshes — the BIST ownership rebuild was never scheduled, so past twenty-six hours of uptime it served stale for the life of the process and only the admin button could clear it. The RAG corpus had the opposite problem: seeded over HTTP from start.sh on every single launch, re-indexing a year of history per bellwether that was already there.

Planned:

  • Hardening: contract tests over the endpoint matrix, broader component coverage.
  • Personalization: portfolio allocation views, saved dashboard layouts, and alarms that survive a change of browser. Watchlists and notes are on Supabase as of v1.5.x, each scoped to its owner.

Contributing

Contributions are welcome, on the backend, the frontend or the data layer. CONTRIBUTING.md covers the development setup, the coding standards and what a reviewable pull request looks like. The short version:

  1. Fork the repository and branch off main — git checkout -b feat/your-feature.
  2. Commit using conventional commits — git commit -m 'feat(api): add funding rate history endpoint'.
  3. Run the gates below.
  4. Open a pull request targeting main, with screenshots for UI changes.
# Backend — the first three are CI; ruff format is enforced by pre-commit.
cd backend && ruff check . && python -m compileall -q -x "venv|data" . && pytest && ruff format --check .

# Frontend — stop the dev server first; it shares .next with the build.
cd frontend && npm run lint && npm run typecheck && npm test && npm run build

Endpoints without test coverage should still be exercised manually against http://localhost:8000/docs; note what you verified in the pull request description.

Participation is governed by the Code of Conduct.


Security

Do not open a public issue for a vulnerability. The security policy sets out what is in scope, how to report privately, and the two deployment settings — the service-role key and CORS_ORIGINS — that account for most of the real risk.


License

MIT. See LICENSE.

Contributors

Yigtwxxdependabot[bot]

Issues