Yigtwxx/mcporter

Call MCPs via TypeScript, masquerading as simple TypeScript API. Or package them as cli.

★ 0Forks 0GitHub ↗Compare

Project website ↗

README

MCPorter 🧳 - Call MCPs from TypeScript or as CLI

MCPorter header banner

npm version CI Status Platforms MIT License

TypeScript runtime, CLI, and code-generation toolkit for the Model Context Protocol.

MCPorter helps you lean into the "code execution" workflows highlighted in Anthropic's Code Execution with MCP guidance: discover the MCP servers already configured on your system, call them directly, compose richer automations in TypeScript, and mint single-purpose CLIs when you need to share a tool. All of that works out of the box -- no boilerplate, no schema spelunking.

Key Capabilities

  • Zero-config discovery. createRuntime() merges your home config (~/.mcporter/mcporter.json[c], or $XDG_CONFIG_HOME/mcporter/mcporter.json[c] when set) first, then config/mcporter.json, plus Cursor/Claude/Codex/Windsurf/OpenCode/VS Code imports, expands ${ENV} placeholders, and pools connections so you can reuse transports across multiple calls.
  • One-command CLI generation. mcporter generate-cli turns any MCP server definition into a ready-to-run CLI, with optional bundling/compilation and metadata for easy regeneration.
  • Typed tool clients. mcporter emit-ts emits .d.ts interfaces or ready-to-run client wrappers so agents/tests can call MCP servers with strong TypeScript types without hand-writing plumbing.
  • Friendly composable API. createServerProxy() exposes tools as ergonomic camelCase methods, automatically applies JSON-schema defaults, validates required arguments, and hands back a CallResult with .text(), .markdown(), .json(), .images(), and .content() helpers.
  • Record/replay fixtures. mcporter record captures MCP JSON-RPC traffic as NDJSON, and mcporter replay serves the same responses deterministically for offline debugging and redacted repros.
  • OAuth and stdio ergonomics. Built-in OAuth caching, log tailing, and stdio wrappers let you work with HTTP, SSE, and stdio transports from the same interface.
  • Ad-hoc connections. Point the CLI at any MCP endpoint (HTTP or stdio) without touching config, then persist it later if you want. Hosted MCPs that expect a browser login (Supabase, Vercel, etc.) are auto-detected—just run mcporter auth <url> and the CLI promotes the definition to OAuth on the fly. See docs/adhoc.md.

What's New in 0.11.0

  • Bridge mode. mcporter serve exposes daemon-managed keep-alive servers as one MCP bridge with readable server__tool names.
  • Headless OAuth. --no-browser, vault seeding, cached-token refresh, and auth: "refreshable_bearer" cover non-interactive deployments.
  • HTTP compatibility. httpFetch: "node-http1" keeps providers that reject Node's built-in fetch working.
  • Safer writes. Config, OAuth vault, JSON output, and cache metadata writes are serialized/atomic so parallel agents stop stepping on each other.
  • Release confidence. 0.11.0 is published on npm and Homebrew, and live/published install smokes are green.

Quick Start

MCPorter auto-discovers the MCP servers you already configured in Cursor, Claude Code/Desktop, Codex, or local overrides. You can try it immediately with npx--no installation required. Need a full command reference (flags, modes, return types)? Check out docs/cli-reference.md.

Call syntax options

# Colon-delimited flags (shell-friendly)
npx mcporter call linear.create_comment issueId:ENG-123 body:'Looks good!'

# Function-call style (matches signatures from `mcporter list`)
npx mcporter call 'linear.create_comment(issueId: "ENG-123", body: "Looks good!")'

# Literal positional values that start with `--`
npx mcporter call server.tool -- --raw-value

List your MCP servers

npx mcporter list
npx mcporter list context7 --schema
npx mcporter list https://mcp.linear.app/mcp --all-parameters
npx mcporter list shadcn.io/api/mcp.getComponents           # URL + tool suffix auto-resolves
npx mcporter list --stdio "bun run ./local-server.ts" --env TOKEN=xyz
  • Add --json to emit a machine-readable summary with per-server statuses (auth/offline/http/error counts) and, for single-server runs, the full tool schema payload.
  • Add --status for a concise single-server status check without tool docs, --exit-code to fail when any checked server is unhealthy, or --quiet for silent health gates.
  • Add --verbose to show every config source that registered the server name (primary first), both in text and JSON list output.

You can now point mcporter list at ad-hoc servers: provide a URL directly or use the new --http-url/--stdio flags (plus --env, --cwd, --name, or --persist) to describe any MCP endpoint. Until you persist that definition, you still need to repeat the same URL/stdio flags for mcporter call—the printed slug only becomes reusable once you merge it into a config via --persist or mcporter config add (use --scope home|project to pick the write target). Follow up with mcporter auth https://… (or the same flag set) to finish OAuth without editing config. Full details live in docs/adhoc.md.

Single-server listings now read like a TypeScript header file so you can copy/paste the signature straight into mcporter call:

linear - Hosted Linear MCP; exposes issue search, create, and workflow tooling.
  23 tools · 1654ms · HTTP https://mcp.linear.app/mcp

  /**
   * Create a comment on a specific Linear issue
   * @param issueId The issue ID
   * @param body The content of the comment as Markdown
   * @param parentId? A parent comment ID to reply to
   */
  function create_comment(issueId: string, body: string, parentId?: string);
  // optional (3): notifySubscribers, labelIds, mentionIds

  /**
   * List documents in the user's Linear workspace
   * @param query? An optional search query
   * @param projectId? Filter by project ID
   */
  function list_documents(query?: string, projectId?: string);
  // optional (11): limit, before, after, orderBy, initiativeId, ...

Here’s what that looks like for Vercel when you run npx mcporter list vercel:

vercel - Vercel MCP (requires OAuth).

  /**
   * Search the Vercel documentation.
   * Use this tool to answer any questions about Vercel’s platform, features, and best practices,
   * including:
   * - Core Concepts: Projects, Deployments, Git Integration, Preview Deployments, Environments
   * - Frontend & Frameworks: Next.js, SvelteKit, Nuxt, Astro, Remix, frameworks configuration and
   *   optimization
   * - APIs: REST API, Vercel SDK, Build Output API
   * - Compute: Fluid Compute, Functions, Routing Middleware, Cron Jobs, OG Image Generation, Sandbox,
   *   Data Cache
   * - AI: Vercel AI SDK, AI Gateway, MCP, v0
   * - Performance & Delivery: Edge Network, Caching, CDN, Image Optimization, Headers, Redirects,
   *   Rewrites
   * - Pricing: Plans, Spend Management, Billing
   * - Security: Audit Logs, Firewall, Bot Management, BotID, OIDC, RBAC, Secure Compute, 2FA
   * - Storage: Blog, Edge Config
   *
   * @param topic Topic to focus the documentation search on (e.g., 'routing', 'data-fetching').
   * @param tokens? Maximum number of tokens to include in the result. Default is 2500.
   */
  function search_vercel_documentation(topic: string, tokens?: number);

  /**
   * Deploy the current project to Vercel
   */
  function deploy_to_vercel();

Required parameters always show; optional parameters stay hidden unless (a) there are only one or two of them alongside fewer than four required fields or (b) you pass --all-parameters. Whenever MCPorter hides parameters it prints Optional parameters hidden; run with --all-parameters to view all fields. so you know how to reveal the full signature. Return types are inferred from the tool schema’s title, falling back to omitting the suffix entirely instead of guessing.

Context7: fetch docs (no auth required)

npx mcporter call context7.resolve-library-id query="React hooks docs" libraryName=react
npx mcporter call context7.query-docs libraryId=/reactjs/react.dev query="useEffect cleanup"

Linear: search documentation (requires LINEAR_API_KEY)

LINEAR_API_KEY=sk_linear_example npx mcporter call linear.search_documentation query="automations"

Chrome DevTools: snapshot the current tab

npx mcporter call chrome-devtools.take_snapshot
npx mcporter call 'linear.create_comment(issueId: "LNR-123", body: "Hello world")'
npx mcporter call linear.create_comment issueId=LNR-123 [email protected]
npx mcporter call https://mcp.linear.app/mcp.list_issues assignee=me
npx mcporter call shadcn.io/api/mcp.getComponent component=vortex   # protocol optional; defaults to https
npx mcporter call linear.listIssues --tool listIssues   # auto-corrects to list_issues
npx mcporter linear.list_issues                         # shorthand: infers `call`
VERCEL_ACCESS_TOKEN=sk_vercel_example npx mcporter call "npx -y vercel-domains-mcp" domain=answeroverflow.com  # quoted stdio cmd + single-tool inference

Tool calls understand a JavaScript-like call syntax, auto-correct near-miss tool names, and emit richer inline usage hints. See docs/call-syntax.md for the grammar and docs/call-heuristic.md for the auto-correction rules.

Helpful flags:

  • --config <path> -- custom config file (defaults to ./config/mcporter.json).
  • --root <path> -- working directory for stdio commands.
  • --log-level <debug|info|warn|error> -- adjust verbosity (respects MCPORTER_LOG_LEVEL).
  • --oauth-timeout <ms> -- shorten/extend the OAuth browser wait; same as MCPORTER_OAUTH_TIMEOUT_MS / MCPORTER_OAUTH_TIMEOUT.
  • --tail-log -- stream the last 20 lines of any log files referenced by the tool response.
  • --output <format> or --raw -- control formatted output (defaults to pretty-printed auto detection).
  • --save-images <dir> (on mcporter call) -- save MCP image content blocks to files in the given directory (opt-in; stdout output shape stays unchanged).
  • --raw-strings (on mcporter call) -- keep numeric-looking argument values (for key=value, key:value, and trailing positional values) as strings.
  • --no-coerce (on mcporter call) -- keep all key=value and positional values as raw strings (disables bool/null/number/JSON coercion).
  • key=@path / --key @path (on mcporter call) -- read a named argument as exact UTF-8 text from a file; use @@ for a literal leading @.
  • -- (on mcporter call) -- stop flag parsing so the remaining tokens stay literal positional values, even when they start with --.
  • --json (on mcporter list) -- emit JSON summaries/counts instead of text. Multi-server runs report per-server statuses, counts, and connection issues; single-server runs include the full tool metadata.
  • --status, --exit-code, --quiet (on mcporter list) -- run concise server health checks through the existing list flow; --quiet suppresses output and exits 1 if anything checked is unhealthy.
  • --output json/raw (on mcporter call) -- when a connection fails, MCPorter prints the usual colorized hint and also emits a structured { server, tool, issue } envelope so scripts can handle auth/offline/http errors programmatically.
  • --json (on mcporter auth) -- emit the same structured connection envelope whenever OAuth/transport setup fails, instead of throwing an error. With --no-browser, it emits auth-start JSON containing authorizationUrl and redirectUrl.
  • --no-browser / --browser none (on mcporter auth or mcporter config login) -- suppress browser launch and print the OAuth authorization URL for headless workflows; MCPORTER_OAUTH_NO_BROWSER=1 / true / yes enables the same behavior.
  • --json (on mcporter emit-ts) -- print a JSON summary describing the emitted files (mode + output paths) instead of text logs—handy when generating artifacts inside scripts.
  • --all-parameters -- show every schema field when listing a server (default output shows at least five parameters plus a summary of the rest).
  • --http-url <https://…> / --stdio "command …" -- describe an ad-hoc MCP server inline. STDIO transports now inherit your current shell environment automatically; add --env KEY=value only when you need to inject/override variables alongside --cwd, --name, or --persist <config.json>. These flags now work with mcporter auth too, so mcporter auth https://mcp.example.com/mcp just works.
  • For OAuth-protected servers such as vercel, run npx mcporter auth vercel once to complete login.

Tip: You can skip the verb entirely—mcporter firecrawl automatically runs mcporter list firecrawl, and dotted tokens like mcporter linear.list_issues dispatch to the call command (typo fixes included).

Server listings default to a 30 s timeout, while calls default to 60 s. Override call timeouts with MCPORTER_CALL_TIMEOUT or --timeout, and list timeouts with MCPORTER_LIST_TIMEOUT. OAuth browser handshakes get a separate 5 minute grace period; pass --oauth-timeout <ms> (or export MCPORTER_OAUTH_TIMEOUT_MS) when you need the CLI to bail out faster while you diagnose stubborn auth flows.

Try an MCP without editing config

# Point at an HTTPS MCP server directly
npx mcporter list --http-url https://mcp.linear.app/mcp --name linear

# Run a local stdio MCP server via Bun
npx mcporter call --stdio "bun run ./local-server.ts" --name local-tools
  • Add --persist config/mcporter.local.json to save the inferred definition for future runs.
  • Use --allow-http if you truly need to hit a cleartext endpoint.
  • See docs/adhoc.md for a deep dive (env overrides, cwd, OAuth).

Keep MCP servers warm with the daemon

  • chrome-devtools, mobile-mcp, and other stateful stdio servers auto-start a per-login daemon the first time you call them so Chrome tabs and device sessions stay alive between agents.
  • Use mcporter daemon status to check whether the daemon is running (and which servers are connected).
  • Stop it anytime with mcporter daemon stop, pre-warm with mcporter daemon start, or bounce it via mcporter daemon restart after tweaking configs/env.
  • All other servers stay ephemeral; add "lifecycle": "keep-alive" to a server entry (or set MCPORTER_KEEPALIVE=name) when you want the daemon to manage it. You can also set "lifecycle": "ephemeral" (or MCPORTER_DISABLE_KEEPALIVE=name) to opt out.
  • The daemon only manages named servers that come from your config/imports. Ad-hoc STDIO/HTTP targets invoked via --stdio …, --http-url …, or inline function-call syntax remain per-process today; persist them into config/mcporter.json (or use --persist) if you need them to participate in the shared daemon.
  • mcporter serve --stdio exposes every daemon-managed keep-alive server as one MCP stdio bridge for clients such as Claude Code or Codex. Register it once, then call namespaced tools like chrome-devtools__list_pages; add --servers a,b to limit the bridge or --http <port> to serve Streamable HTTP on localhost at /mcp. HTTP mode also exposes /mcp/<server> for one selected keep-alive server with its original, unprefixed tool names.
  • Troubleshooting? Run mcporter daemon start --log (or --log-file /tmp/daemon.log) to tee stdout/stderr into a file, and add --log-servers chrome-devtools when you only want call traces for a specific MCP. Per-server configs can also set "logging": { "daemon": { "enabled": true } } to force detailed logging for that entry.

Friendlier Tool Calls

  • Function-call syntax. Instead of juggling --flag value, you can call tools as mcporter call 'linear.create_issue(title: "Bug", team: "ENG")'. The parser supports nested objects/arrays, lets you omit labels when you want to rely on schema order (e.g. mcporter 'context7.resolve-library-id("React hooks docs", "react")'), and surfaces schema validation errors clearly. Deep dive in docs/call-syntax.md.
  • Flag shorthand still works. Prefer CLI-style arguments? Stick with mcporter linear.create_issue title=value team=value, title=value, title:value, or even title: value—the CLI now normalizes all three forms.
  • Unknown long flags fail fast. mcporter call server.tool --source import now errors instead of silently turning --source into a positional tool argument. Use source=import, --args '{"source":"import"}', or insert -- before literal positional values that begin with --.
  • Cheatsheet. See docs/tool-calling.md for a quick comparison of every supported call style (auto-inferred verbs, flags, function-calls, and ad-hoc URLs).
  • Auto-correct. If you typo a tool name, MCPorter inspects the server’s tool catalog, retries when the edit distance is tiny, and otherwise prints a Did you mean …? hint. The heuristic (and how to tune it) is captured in docs/call-heuristic.md.
  • Richer single-server output. mcporter list <server> now prints TypeScript-style signatures, inline comments, return-shape hints, and command examples that mirror the new call syntax. Optional parameters stay hidden by default—add --all-parameters or --schema whenever you need the full JSON schema. Prefer a tighter scan? mcporter list <server> --brief (or --signatures) keeps just the compact signatures and optional summaries.

Installation

Run instantly with npx

npx mcporter list

Add to your project

pnpm add mcporter

Install globally with npm

npm install -g mcporter

Homebrew (steipete/tap)

brew tap steipete/tap
brew install steipete/tap/mcporter

The tap publishes alongside npm. If you run into issues with an older tap install, run brew update before reinstalling.

One-shot calls from code

import { callOnce } from 'mcporter';

const result = await callOnce({
  server: 'firecrawl',
  toolName: 'crawl',
  args: { url: 'https://anthropic.com' },
});

console.log(result); // raw MCP envelope

callOnce automatically discovers the selected server (including Cursor/Claude/Codex/Windsurf/OpenCode/VS Code imports), handles OAuth prompts, and closes transports when it finishes. It is ideal for manual runs or wiring MCPorter directly into an agent tool hook. In headless contexts, pass disableOAuth: true to suppress interactive OAuth and rely on cached tokens only — the library equivalent of the CLI's --no-oauth flag.

Compose Automations with the Runtime

import { createRuntime } from 'mcporter';

const runtime = await createRuntime();

const tools = await runtime.listTools('context7');
const result = await runtime.callTool('context7', 'resolve-library-id', {
  args: { query: 'React hooks docs', libraryName: 'react' },
});

console.log(result); // prints JSON/text automatically because the CLI pretty-prints by default
await runtime.close(); // shuts down transports and OAuth sessions

Reach for createRuntime() when you need connection pooling, repeated calls, or advanced options such as explicit timeouts and log streaming. The runtime reuses transports, refreshes OAuth tokens, and only tears everything down when you call runtime.close().

Compose Tools in Code

The runtime API is built for agents and scripts, not just humans at a terminal.

import { createRuntime, createServerProxy } from 'mcporter';

const runtime = await createRuntime();
const chrome = createServerProxy(runtime, 'chrome-devtools');
const linear = createServerProxy(runtime, 'linear');

const snapshot = await chrome.takeSnapshot();
console.log(snapshot.text());

const docs = await linear.searchDocumentation({
  query: 'automations',
  page: 0,
});
console.log(docs.json());

Friendly ergonomics baked into the proxy and result helpers:

  • Property names map from camelCase to kebab-case tool names (takeSnapshot -> take_snapshot).
  • Positional arguments map onto schema-required fields automatically, and option objects respect JSON-schema defaults.
  • Results are wrapped in a CallResult, so you can choose .text(), .markdown(), .json(), .images(), .content(), or access .raw when you need the full envelope.

Drop down to runtime.callTool() whenever you need explicit control over arguments, metadata, or streaming options.

Call mcporter list <server> any time you need the TypeScript-style signature, optional parameter hints, and sample invocations that match the CLI's function-call syntax. Add --brief or --signatures when you only want compact signatures.

Generate a Standalone CLI

Turn any server definition into a shareable CLI artifact:

npx mcporter generate-cli \
  --command https://mcp.context7.com/mcp

# Outputs:
#   context7.ts        (TypeScript template with embedded schemas)
#   context7.js        (bundled CLI via Rolldown or Bun, depending on runtime)

Convert the chrome-devtools MCP to a CLI via this one weird trick:

npx mcporter generate-cli --command "npx -y chrome-devtools-mcp@latest"

Tip: you can drop --command when the inline command is the first positional argument (e.g., npx mcporter generate-cli "npx -y chrome-devtools-mcp@latest").

  • --name overrides the inferred CLI name.
  • Add --description "..." if you want a custom summary in the generated help output (otherwise mcporter asks the MCP server for its own description/title during generation).
  • Generated CLIs inherit the same color-aware help layout as mcporter itself: invoking the binary with no arguments shows the embedded tool list + quick start, and each --help page uses bold titles + dimmed descriptions when stdout is a TTY.
  • Add --bundle [path] to emit a bundle alongside the template (Rolldown when targeting Node, Bun automatically when the runtime resolves to Bun; override with --bundler rolldown|bun).
  • --output <path> writes the template somewhere specific.
  • --runtime bun|node picks the runtime for generated code (Bun required for --compile).
  • Add --compile to emit a Bun-compiled binary; MCPorter cleans up intermediate bundles when you omit --bundle.
  • Use --include-tools a,b,c or --exclude-tools a,b,c to generate a CLI for a subset of tools (mutually exclusive).
  • Use --from <artifact> (optionally --dry-run) to regenerate an existing CLI using its embedded metadata.
  • Prefer a positional shorthand if the server already lives in your config/imports: npx mcporter generate-cli linear --bundle dist/linear.js.
  • --server/--command accept HTTP URLs, optional .tool suffixes, and even scheme-less hosts (shadcn.io/api/mcp.getComponents).

Every artifact embeds regeneration metadata (generator version, resolved server definition, invocation flags). Use:

npx mcporter inspect-cli dist/context7.js     # human-readable summary
npx mcporter generate-cli --from dist/context7.js  # replay with latest mcporter

Agents should usually get one small skill per MCP server or workflow instead of a generic "all of mcporter" skill. See docs/agent-skills.md for the pattern and a copyable template.

Generate Typed Clients

Use mcporter emit-ts when you want strongly typed tooling without shipping a full CLI. It reuses the same signatures/doc blocks as mcporter list, so the generated headers stay in sync with what the CLI shows.

# Types-only interface (Promise signatures)
npx mcporter emit-ts linear --out types/linear-tools.d.ts

# Client wrapper (creates a reusable proxy factory alongside the .d.ts)
npx mcporter emit-ts linear --mode client --out clients/linear.ts
  • --mode types (default) produces a .d.ts interface you can import anywhere.
  • --mode client emits the .d.ts and a .ts helper that wraps createRuntime / createServerProxy for you.
  • Add --include-optional whenever you want every optional field spelled out (mirrors mcporter list --all-parameters).
  • Add --json to emit a structured summary (mode plus output paths) instead of plain-text logs when scripting emit-ts.
  • The <server> argument also understands HTTP URLs and selectors with .tool suffixes or missing protocols—mirroring the main CLI.

See docs/emit-ts.md for the full flag reference plus inline snapshots of the emitted files.

Configuration Reference

Manage this file with mcporter config list|get|add|remove|import when you’d rather avoid hand-editing JSON; see docs/config.md for the full walkthrough. Config files are parsed as JSONC, so inline // and /* ... */ comments plus trailing commas are supported in both mcporter.json and mcporter.jsonc.

Manage configs with mcporter config

Run mcporter config … via your package manager (pnpm, npm, npx, etc.) when you want an interactive view of project MCPs:

  • config list shows only local entries by default and, on TTYs, prints a summary of every other config file (Cursor, Claude, Windsurf, VS Code, etc.) with counts and sample names. Add --source import to inspect those imported entries directly or --json for scripting.
  • config get/remove/logout reuse the fuzzy matching logic from mcporter list/call, so typos like sshadcn auto-correct to shadcn (with a dimmed notice) and ambiguous names surface “Did you mean …?” hints.
  • config import <kind> --copy pulls editor-managed entries into config/mcporter.json, letting you customize or remove them locally without touching upstream files.
  • Every subcommand honors --config <path> / --root <dir>, making it easy to juggle multiple project configs or workspace-specific overrides.

config/mcporter.json mirrors Cursor/Claude's shape:

{
  "mcpServers": {
    "context7": {
      "description": "Context7 docs MCP",
      "baseUrl": "https://mcp.context7.com/mcp",
      "headers": {
        "Authorization": "$env:CONTEXT7_API_KEY",
      },
    },
    "chrome-devtools": {
      "command": "npx",
      "args": ["-y", "chrome-devtools-mcp@latest", "--autoConnect"],
      "env": { "npm_config_loglevel": "error" },
    },
  },
  "imports": ["cursor", "claude-code", "claude-desktop", "codex", "windsurf", "opencode", "vscode"],
}

What MCPorter handles for you:

  • ${VAR}, ${VAR:-fallback}, and $env:VAR interpolation for config strings. Secret-bearing headers, env, and bearer-token placeholders stay lazy and resolve at runtime.
  • Automatic OAuth token caching in the shared vault (~/.mcporter/credentials.json, or $XDG_DATA_HOME/mcporter/credentials.json when set) unless you override tokenCacheDir.
  • Stdio commands inherit the directory of the file that defined them (imports or local config).
  • Import precedence matches the array order; omit imports to use the default ["cursor", "claude-code", "claude-desktop", "codex", "windsurf", "opencode", "vscode"].
  • chrome-devtools-mcp --autoConnect receives a small compatibility patch while upstream auto-connect can hang on busy Chrome profiles; set MCPORTER_DISABLE_CHROME_DEVTOOLS_COMPAT=1 to opt out.

OAuth-protected servers

If an HTTP MCP requires browser login (OAuth), persist it with --auth oauth (or set "auth": "oauth" in JSON), then run mcporter auth once:

npx mcporter config add notion https://mcp.notion.com/mcp --auth oauth
npx mcporter auth notion

On headless hosts, use npx mcporter auth notion --no-browser to print the authorization URL instead of launching the platform browser. Treat the printed URL as sensitive operational output. Keep the mcporter auth process alive until the browser redirects back to the printed redirectUrl; process managers that exit or clean up the command after capturing stdout can kill the loopback callback listener before OAuth completes. Run the command from a persistent terminal session, tmux, or a supervised background process such as nohup, and if you open the URL on another machine, make sure the callback port is reachable through a loopback-only tunnel or a configured oauthRedirectUrl.

Providers that do not support dynamic client registration can use a pre-registered app:

{
  "mcpServers": {
    "hubspot": {
      "baseUrl": "https://mcp.hubspot.com/mcp",
      "auth": "oauth",
      "oauthClientId": "your-client-id",
      "oauthClientSecretEnv": "HUBSPOT_CLIENT_SECRET",
      "oauthTokenEndpointAuthMethod": "client_secret_post",
      "oauthRedirectUrl": "http://127.0.0.1:3434/callback",
    },
  },
}

Keep client secrets in environment variables or private machine-local configs, and register the exact oauthRedirectUrl with the provider.

Refreshable bearer tokens (non-interactive OAuth)

For servers with pre-seeded OAuth tokens that need automatic refresh without browser prompts, use auth: "refreshable_bearer". HTTP servers receive Authorization: Bearer <token> headers; STDIO servers require refresh.accessTokenEnv to inject the token as an environment variable:

{
  "mcpServers": {
    "example": {
      "command": "uvx",
      "args": ["example-mcp-server"],
      "auth": "refreshable_bearer",
      "refresh": {
        "tokenEndpoint": "https://api.example.com/oauth/token",
        "clientIdEnv": "EXAMPLE_CLIENT_ID",
        "clientSecretEnv": "EXAMPLE_CLIENT_SECRET",
        "clientAuthMethod": "client_secret_basic",
        "refreshSkewSeconds": 300,
        "accessTokenEnv": "EXAMPLE_ACCESS_TOKEN",
      },
    },
  },
}

mcporter refreshes tokens before they expire (default 5 minutes early) using the refresh token from the vault. For keep-alive stdio servers that can't reload credentials after startup, use "lifecycle": "ephemeral" or restart the daemon before tokens expire.

Headless deployments that already have OAuth tokens can seed the vault without reproducing mcporter's internal vault key:

npx mcporter vault set hubspot --tokens-file ./tokens.json
npx mcporter vault set hubspot --stdin < tokens.json
npx mcporter vault clear hubspot

The JSON payload is { "tokens": { ... }, "clientInfo": { ... } }; tokens is required and clientInfo is optional.

Provide configPath or rootDir to CLI/runtime calls when you juggle multiple config files side by side.

Config resolution order & system-level configs

mcporter reads exactly one primary config per run. The lookup order is:

  1. The path you pass via --config (or programmatic configPath).
  2. The MCPORTER_CONFIG environment variable (set it in your shell to apply everywhere).
  3. <root>/config/mcporter.json inside the current project.
  4. $XDG_CONFIG_HOME/mcporter/mcporter.json[c] when XDG_CONFIG_HOME is set, falling back to ~/.mcporter/mcporter.json[c] when no XDG mcporter config exists and the project file is missing.

All mcporter config … mutations write back to whichever file was selected by that order. To manage a system-wide config explicitly, point the CLI at it:

mcporter config --config ~/.mcporter/mcporter.json add global-server https://api.example.com/mcp

Set MCPORTER_CONFIG=~/.mcporter/mcporter.json in your shell profile when you want that file to be the default everywhere (handy for npx mcporter … runs).

mcporter honors XDG Base Directory env vars for its own files when those vars are explicitly set: XDG_CONFIG_HOME for home configs, XDG_DATA_HOME for the OAuth vault, XDG_CACHE_HOME for schema caches, and XDG_STATE_HOME for daemon/runtime state. If the matching XDG var is unset or relative, mcporter keeps the legacy ~/.mcporter path. Config discovery is XDG-first but still probes ~/.mcporter/mcporter.json[c] when no XDG mcporter config exists, which keeps embedders from hiding the user registry when they set XDG_CONFIG_HOME for another tool. Existing explicit overrides still win.

Tool Filtering

Server definitions can hide or block exact tool names with either allowedTools or blockedTools:

{
  "mcpServers": {
    "slack-readonly": {
      "baseUrl": "https://example.com/slack/mcp",
      "allowedTools": ["channels_list", "conversations_history"],
    },
    "filesystem-safe": {
      "command": "npx -y @modelcontextprotocol/server-filesystem ~/Downloads",
      "blockedTools": ["write_file", "delete_file", "move_file"],
    },
  },
}

allowedTools is an allowlist: only listed tools appear in mcporter list and can be called. An empty array blocks every tool. blockedTools is a blocklist: listed tools are hidden and rejected by mcporter call. Use exact tool names only, and choose one mode per server.

Testing and CI

Command Purpose
pnpm check Oxfmt formatting plus Oxlint/tsgolint gate.
pnpm build TypeScript compilation (emits dist/).
pnpm test Vitest unit and integration suites (streamable HTTP fixtures included).

CI runs the same trio via GitHub Actions.

Related

Debug Hanging Servers Quickly

Use tmux to keep long-running CLI sessions visible while you investigate lingering MCP transports:

tmux new-session -- pnpm mcporter:list

Let it run in the background, then inspect the pane (tmux capture-pane -pt <session>), tail stdio logs, or kill the session once the command exits. Pair this with MCPORTER_DEBUG_HANG=1 when you need verbose handle diagnostics. More detail: docs/tmux.md and docs/hang-debug.md.

License

MIT -- see LICENSE.

Further reading: docs/tool-calling.md, docs/call-syntax.md, docs/adhoc.md, docs/emit-ts.md, docs/tmux.md.

Contributors

steipetevincentkoczm2231feniixdependabot[bot]ryoppippirawwerksaryasaatvikprateek-oaicaseygHamzaa6296v2nicdedenesevzqmonotykamaryumutkeltekjiezeng2004-designahonnclawSeanclawsweeper[bot]ebbsanchezbadmooKentonYumavammvanhornLoveacupLDMB123KrasimirKralevkennyfrccosminilie

Issues