carlh7777/phase

A Magic: The Gathering rules engine and game client — Rust + WASM + React

★ 0Forks 0RustGitHub ↗Compare

Project website ↗

README

phase.rs

An open-source Magic: The Gathering rules engine and game client

Play Preview Play Online Download Support on Ko-fi

Quick Start · Features · Architecture · Development · Discord · Ask DeepWiki

Card Coverage Keywords Cards
Pauper Pioneer Modern Standard Legacy Vintage Commander


phase.rs gameplay

A Rust-native MTG engine compiling to native and WASM, powering a Tauri desktop app, browser PWA, and WebSocket multiplayer. Implements comprehensive MTG rules using functional architecture — pure reducers, discriminated unions, and immutable state with structural sharing — with an Arena-quality React/TypeScript UI.

Story

I'm Matt — a millennial software engineer who loves Magic. My six-year-old son asks me to play with him all the time, but the real game is just too complicated for a kid his age.

So I built Alchemy (source) — a simplified, kid-friendly version of MTG we could play together on our iPads. Fewer keywords, no lands, energy that builds each turn, and an adaptive learning mode where he solves math problems for combat bonuses. I had a working version in a single afternoon and fleshed it out over the following week.

After that I wanted to see how far I could push it — a real MTG rules engine in Rust, compiling to WASM, with the same React frontend so the whole thing runs in a browser. This whole project went from nothing to where it is now in a matter of weeks.

I'm not trying to make money off this. There are no ads. I'm just a dude who likes Magic.

Features

  • Rules engine — Turns, priority, stack, combat, state-based actions, layers, triggers, replacement effects
  • 34,300+ cards — Parsed from MTGJSON with format support (Commander, Modern, Pioneer, Standard, and more)
  • AI opponent — Per-card decision logic, game tree search, and evaluation heuristics
  • Game UI — Battlefield, hand, stack, targeting overlays, mana payment, animations, and ambient audio
  • Multiplayer — WebSocket server with hidden information, lobby system, and WebRTC peer-to-peer
  • Metagame feeds — Automated scraping of top decks from MTGGoldfish, updated daily
  • Deck builder — Card search, visual builder, and .dck/.dec import
  • Cross-platform — Tauri desktop (Windows, macOS, Linux), browser PWA, and tablet
  • Card images — Scryfall integration with IndexedDB caching

Contribute a Card with Your LLM

Thousands of cards are still unimplemented. If you use Claude Code, Codex CLI, or a similar agent, you can "lend your LLM" an hour and ship a real PR — even if you don't have a Rust toolchain. The LLM does all the work; you just paste a prompt.

Hand this to your LLM:

Read https://raw.githubusercontent.com/phase-rs/phase/main/docs/AI-CONTRIBUTOR.md
and follow it end-to-end to implement {a card I name, or pick one for me}.
Use the $engine-implementer skill. Use high thinking. Don't stop for my input.
Open a PR when done.

Full procedure, two tracks (developer / non-developer), and copy-paste prompts for LLM UIs without web fetch: docs/AI-CONTRIBUTOR.md.

Quick Start

Prerequisites

  • Rust toolchain
  • wasm32 target: rustup target add wasm32-unknown-unknown (Windows: see below)
  • wasm-bindgen-cli: cargo install [email protected]
  • wasm-opt (optional): brew install binaryen or apt install binaryen
  • Node.js 22+ and pnpm: npm i -g pnpm

Windows

rustup on Windows defaults to the GNU toolchain, which requires dlltool.exe and fails with "error calling dlltool 'dlltool.exe': program not found". You need Visual Studio Build Tools with the Desktop development with C++ workload, then switch to the MSVC host:

rustup set default-host x86_64-pc-windows-msvc
rustup toolchain install nightly --target wasm32-unknown-unknown

Verify with rustup show active-toolchain — it should end in x86_64-pc-windows-msvc.

The setup scripts also require jq and curl, which are not installed by default on Windows. Install them before running ./scripts/setup.sh:

winget install jqlang.jq
winget install curl.curl   # skip if curl is already on your PATH

Open a new terminal after installing so the updated PATH takes effect.

Setup

git clone https://github.com/phase-rs/phase && cd phase
./scripts/setup.sh     # Fetches data, builds WASM, installs deps
cd client && pnpm dev  # Start dev server at localhost:5173

If tilt is installed, setup.sh skips the eager WASM + card-data build and tilt up handles them. Flags: --agent (LLM mode — skip Scryfall art; see docs/AI-CONTRIBUTOR.md), --no-tilt (force inline build).

Manual Steps

./scripts/gen-card-data.sh            # generate card-data.json
./scripts/build-wasm.sh               # Build WASM bindings
cd client && pnpm install && pnpm dev # Start frontend

Dedicated Server

The easiest way to run a dedicated multiplayer server is the Docker image:

docker volume create phase-server-data
docker run -d \
  --platform linux/amd64 \
  --name phase-server \
  --restart unless-stopped \
  -p 9374:9374 \
  -v phase-server-data:/var/lib/phase-server \
  -e PHASE_LOBBY_ONLY=true \
  -e PHASE_CORS_ORIGIN='*' \
  ghcr.io/phase-rs/phase-server:latest

The image includes the server binary and generated card data. It exposes:

  • http://localhost:9374/health for health checks
  • ws://localhost:9374/ws for WebSocket clients

Server Modes and Options

PHASE_LOBBY_ONLY=true runs the same lightweight matchmaking mode as the public phase.rs server. Omit it for full server-hosted games and drafts.

Docker uses environment variables for the common options:

Environment variable Equivalent flag Default Notes
PORT --port, -p 9374 Port inside the container
PHASE_DATA_DIR --data-dir, -d /var/lib/phase-server Container data directory
PHASE_CORS_ORIGIN --cors-origin permissive Use * or a specific origin
PHASE_LOBBY_ONLY --lobby-only false Matchmaking broker mode
PHASE_LOG_JSON --log-json false Emit JSON logs
PHASE_LOG_DIR --log-dir stdout Write logs to files

You can also pass server flags after the image name:

docker run --rm --platform linux/amd64 -p 9374:9374 ghcr.io/phase-rs/phase-server:latest --lobby-only --cors-origin '*'

For public internet play, put the container behind a TLS reverse proxy and give players the wss://your-domain.example/ws URL. If the reverse proxy is on the same host, bind Docker to localhost instead:

docker run -d \
  --platform linux/amd64 \
  --name phase-server \
  --restart unless-stopped \
  -p 127.0.0.1:9374:9374 \
  -v phase-server-data:/var/lib/phase-server \
  -e PHASE_LOBBY_ONLY=true \
  -e PHASE_CORS_ORIGIN='*' \
  ghcr.io/phase-rs/phase-server:latest

The same flags work when running the phase-server release binary directly.

Architecture

Rust Workspace (crates/)

Crate Description
engine Core rules engine: types, game logic, parser, card database
phase-ai AI opponent: evaluation, legal actions, search
engine-wasm WASM bindings via wasm-bindgen + tsify
server-core Server-side game session management
phase-server Axum WebSocket server for multiplayer
feed-scraper Metagame deck scraper (MTGGoldfish)

Dependency flow: engine <- phase-ai <- engine-wasm / server-core <- phase-server (feed-scraper is standalone)

Frontend (client/)

React + TypeScript + Tailwind v4 + Zustand + Framer Motion + Vite

Transport-agnostic EngineAdapter interface with multiple implementations:

  • WasmAdapter — Direct WASM calls (browser/PWA)
  • TauriAdapter — Tauri IPC (desktop)
  • WebSocketAdapter — WebSocket (multiplayer)
  • P2PHostAdapter / P2PGuestAdapter — WebRTC peer-to-peer via PeerJS

Design Principles

  • Pure reducers — apply(state, action) -> ActionResult with no mutation
  • Discriminated unions — Rust enums serialize to tagged TS unions via serde + tsify
  • Structural sharing — Immutable state via rpds persistent data structures

Development

Build Commands

Tip: If you're running Tilt (tilt up), prefer ./scripts/tilt-wait.sh <resource> over the direct cargo/pnpm equivalents — Tilt continuously rebuilds in the background and tilt-wait.sh blocks only until the relevant resource settles, avoiding target-lock contention. When Tilt is not running, fall back to the commands below. See CLAUDE.md § "Canonical verification pattern" for the conditional template used by agents and skills.

# Rust (uses cargo-nextest for test execution)
cargo test-all                             # Run all tests (nextest)
cargo clippy --all-targets -- -D warnings  # Lint
cargo fmt --all -- --check                 # Format check

# WASM
./scripts/build-wasm.sh                    # Build WASM (release)
./scripts/build-wasm.sh debug              # Build WASM (debug)

# Frontend
cd client
pnpm install                               # Install dependencies
pnpm dev                                   # Vite dev server
pnpm build                                 # TypeScript check + Vite build
pnpm lint                                  # ESLint
pnpm test                                  # Vitest

Cargo Aliases

cargo test-all          # Run all tests (nextest)
cargo clippy-strict     # Lint with -D warnings
cargo export-cards      # Run card data exporter
cargo coverage          # Card support coverage report
cargo wasm              # Build WASM (debug)
cargo wasm-release      # Build WASM (release)
cargo serve             # Run multiplayer server
cargo scrape-feeds      # Scrape metagame feeds

Project Structure

crates/
  engine/             Core rules engine
  engine-wasm/        WASM bindings
  phase-ai/           AI opponent
  server-core/        Server session management
  phase-server/       Axum WebSocket server
  feed-scraper/       Metagame deck scraper
client/               React frontend
scripts/              Build and setup scripts

Contact

Non-Commercial Fan Project

phase.rs is a non-commercial fan project built under the spirit of the Wizards of the Coast Fan Content Policy. It exists for hobbyist, educational, and research use only.

  • No bundled Wizards assets. This repository does not distribute MTG card images, card art, mana symbol artwork, card-frame graphics, or the Comprehensive Rules document. Card images and mana symbols are fetched from Scryfall at runtime by the user's browser. Card metadata is sourced from MTGJSON.
  • No affiliation. phase.rs is not affiliated with, endorsed by, sponsored by, or approved by Wizards of the Coast LLC or Hasbro, Inc.

Magic: The Gathering, Planeswalker, the mana symbols, and all associated names, text, and imagery are trademarks and copyrights of Wizards of the Coast LLC. All rights reserved by their respective owners.

If you believe content in this repository infringes your rights, please see DMCA.md.

Acknowledgments

License

Dual-licensed under MIT or Apache 2.0, at your option.

Contributors

matthewevanskiannidevdripsmvcpjoaovictor712lgraymike-theDudeWhovencroftphilluiz2323ntindlejsdevninjapekar9781claytonlin1110andriypolanskicarlos4sglorysr1209-pngnickmopenjason020818Erckddminion1227Lobster-0429carlh7777MichaelMillsOfficialglorydavid03023monsterdavidliu-uxGildardoDevdale053jonathanchang31milosde111dearsishsacocalypso

Issues