GithubHelp home page GithubHelp logo

ss-prediction's Introduction

Protein Secondary structure Prediction

This prediction technique is based on the secondary structure database provided by DSSP (http://swift.cmbi.ru.nl/gv/dssp/) and Protein Data Bank. From DSSP Database 56272 Unique Chains are identified for sampling and the data is provided in two files.

To predict the secondary structure run the new_prediction.py program with two arguments (no_of_sampling and the single_letter_aminoacid_sequence)

Example

python new_prediction.py 4 CVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHW

          EEECECCCCEEEHHCCCCCCCCCCEEEECCCHHHHCCHHHCHCHCCCCCCEECCCHHHCCCCCCHHHHCHHHHH
          EEEEECCCCEEEHHCCCCCCCCCCHHEECCCHHHHCCHHCCHHHCCCCCCEECHHHHCCCCCCCHHHCCCHHHH
          CCCCHCHCCEEEHHCCCCCCCCCCCEEECCCHHHHCCHHCCHHHCCCCCCEECCHHHCCCCCCCHHHHHHHHHH
          EEEEEECCEEEECCCCCCCCCEECCEEECCCCEEECHHHHCCCCCCCCCEECCCCHCCCCCCCCHHHHHHHCCC

In this case the number of sampling is four so the program samples 56272 protein sequence in to four groups. Secondary structure will be predicted using each group of data separately and program generates four secondary structures. Best sequence has to be found out using other techniques, which are not discussed here.

No of sampling decides the accuracy of the prediction. It is found that if we use a sampling of 512 almost all the 56272 aminoacid sequence produce a result of more than 95% accuracy. That is out of 512 secondary structure sequence produced accuracy of the one secondary structure sequence will be more than 95%.

ss-prediction's People

Watchers

 avatar  avatar

Recommend Projects

  • React photo React

    A declarative, efficient, and flexible JavaScript library for building user interfaces.

  • Vue.js photo Vue.js

    ๐Ÿ–– Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.

  • Typescript photo Typescript

    TypeScript is a superset of JavaScript that compiles to clean JavaScript output.

  • TensorFlow photo TensorFlow

    An Open Source Machine Learning Framework for Everyone

  • Django photo Django

    The Web framework for perfectionists with deadlines.

  • D3 photo D3

    Bring data to life with SVG, Canvas and HTML. ๐Ÿ“Š๐Ÿ“ˆ๐ŸŽ‰

Recommend Topics

  • javascript

    JavaScript (JS) is a lightweight interpreted programming language with first-class functions.

  • web

    Some thing interesting about web. New door for the world.

  • server

    A server is a program made to process requests and deliver data to clients.

  • Machine learning

    Machine learning is a way of modeling and interpreting data that allows a piece of software to respond intelligently.

  • Game

    Some thing interesting about game, make everyone happy.

Recommend Org

  • Facebook photo Facebook

    We are working to build community through open source technology. NB: members must have two-factor auth.

  • Microsoft photo Microsoft

    Open source projects and samples from Microsoft.

  • Google photo Google

    Google โค๏ธ Open Source for everyone.

  • D3 photo D3

    Data-Driven Documents codes.