kidonng/fzf

:cherry_blossom: A command-line fuzzy finder

★ 0Forks 0GitHub ↗Compare

Project website ↗

README


fzf - a command-line fuzzy finder github-actions

fzf is a general-purpose command-line fuzzy finder.

It's an interactive filter program for any kind of list; files, command history, processes, hostnames, bookmarks, git commits, etc. It implements a "fuzzy" matching algorithm, so you can quickly type in patterns with omitted characters and still get the results you want.

Highlights

  • 📦 Portable — Distributed as a single binary for easy installation
  • ⚡ Blazingly fast — Highly optimized code instantly processes millions of items
  • 🛠️ Extremely versatile — Fully customizable via an event-action binding mechanism
  • 🔋 Batteries included — Includes integration with bash, zsh, fish, Vim, and Neovim

Sponsors ❤️

I would like to thank all the sponsors of this project who make it possible for me to continue to improve fzf.

If you'd like to sponsor this project, please visit https://github.com/sponsors/junegunn.

User avatar: miyanokomiyaUser avatar: Jon GjengsetUser avatar: Kyle L. DavisUser avatar: Frederick ZhangUser avatar: Moritz DietzUser avatar: Mikkel MalmbergUser avatar: Pierre DubouilhUser avatar: Fulvio ScapinUser avatar: Ryan Roden-CorrentUser avatar: Jordan ArentsenUser avatar: Alex ViscreanuUser avatar: David BalateroUser avatar: User avatar: Ben ElanUser avatar: Paweł DudaUser avatar: User avatar: Damien RajonUser avatar: ArtBITUser avatar: User avatar: HovisUser avatar: Yarden zamirUser avatar: Darius JondaUser avatar: Cristian DominguezUser avatar: Chang-Hung LiangUser avatar: Ben LechlitnerUser avatar: george looshchUser avatar: Takumi KAGIYAMAUser avatar: Paul OLeary McCannUser avatar: Robert BeegerUser avatar: Yoway BuornUser avatar: Josh ScalisiUser avatar: Alec ScottUser avatar: thanks.devUser avatar: Artur SapekUser avatar: Guillaume GelinUser avatar: User avatar: Rob LevyUser avatar: Gloria ZhaoUser avatar: Markus KollerUser avatar: User avatar: jamesobUser avatar: Johan Le BrayUser avatar: Panos LampropoulosUser avatar: bespinianUser avatar: Markus Schneider-PargmannUser avatar: Ben SmithUser avatar: Charlie EganUser avatar: Tyler HobbsUser avatar: Neil ParikhUser avatar: Jamie SchembriUser avatar: dockienUser avatar: Russell GilmoreUser avatar: Lukas WaymannUser avatar: Farzad SadeghiUser avatar: User avatar: NorbsUser avatar: YuUser avatar: Fotios ValasiadisUser avatar: Joonas KorhonenUser avatar: Bruno PazUser avatar: Filippos LanarasUser avatar: Freshleaf MediaUser avatar: User avatar: Timothy Bennett

Table of Contents

Installation

Using Homebrew

You can use Homebrew (on macOS or Linux) to install fzf.

brew install fzf

Important

To set up shell integration (key bindings and fuzzy completion), see the instructions below.

fzf is also available via MacPorts: sudo port install fzf

Linux packages

Package Manager Linux Distribution Command
APK Alpine Linux sudo apk add fzf
APT Debian 9+/Ubuntu 19.10+ sudo apt install fzf
Conda conda install -c conda-forge fzf
DNF Fedora sudo dnf install fzf
Nix NixOS, etc. nix-env -iA nixpkgs.fzf
Pacman Arch Linux sudo pacman -S fzf
pkg FreeBSD pkg install fzf
pkgin NetBSD pkgin install fzf
pkg_add OpenBSD pkg_add fzf
Portage Gentoo emerge --ask app-shells/fzf
Spack spack install fzf
XBPS Void Linux sudo xbps-install -S fzf
Zypper openSUSE sudo zypper install fzf

Important

To set up shell integration (key bindings and fuzzy completion), see the instructions below.

Packaging status

Windows packages

On Windows, fzf is available via Chocolatey, Scoop, Winget, and MSYS2:

Package manager Command
Chocolatey choco install fzf
Scoop scoop install fzf
Winget winget install fzf
MSYS2 (pacman) pacman -S $MINGW_PACKAGE_PREFIX-fzf

Using git

Alternatively, you can "git clone" this repository to any directory and run install script.

git clone --depth 1 https://github.com/junegunn/fzf.git ~/.fzf
~/.fzf/install

The install script will add lines to your shell configuration file to modify $PATH and set up shell integration.

Binary releases

You can download the official fzf binaries from the releases page.

Setting up shell integration

Add the following line to your shell configuration file.

  • bash
    # Set up fzf key bindings and fuzzy completion
    eval "$(fzf --bash)"
  • zsh
    # Set up fzf key bindings and fuzzy completion
    source <(fzf --zsh)
  • fish
    # Set up fzf key bindings
    fzf --fish | source

Note

--bash, --zsh, and --fish options are only available in fzf 0.48.0 or later. If you have an older version of fzf, or want finer control, you can source individual script files in the /shell directory. The location of the files may vary depending on the package manager you use. Please refer to the package documentation for more information. (e.g. apt show fzf)

Tip

You can disable CTRL-T or ALT-C binding by setting FZF_CTRL_T_COMMAND or FZF_ALT_C_COMMAND to an empty string when sourcing the script. For example, to disable ALT-C binding:

  • bash: FZF_ALT_C_COMMAND= eval "$(fzf --bash)"
  • zsh: FZF_ALT_C_COMMAND= source <(fzf --zsh)
  • fish: fzf --fish | FZF_ALT_C_COMMAND= source

Setting the variables after sourcing the script will have no effect.

Vim/Neovim plugin

If you use vim-plug, add this to your Vim configuration file:

Plug 'junegunn/fzf', { 'do': { -> fzf#install() } }
Plug 'junegunn/fzf.vim'
  • junegunn/fzf provides the basic library functions
    • fzf#install() makes sure that you have the latest binary
  • junegunn/fzf.vim is a separate project that provides a variety of useful commands

To learn more about the Vim integration, see README-VIM.md.

Tip

If you use Neovim and prefer Lua-based plugins, check out fzf-lua.

Upgrading fzf

fzf is being actively developed, and you might want to upgrade it once in a while. Please follow the instruction below depending on the installation method used.

  • git: cd ~/.fzf && git pull && ./install
  • brew: brew update; brew upgrade fzf
  • macports: sudo port upgrade fzf
  • chocolatey: choco upgrade fzf
  • vim-plug: :PlugUpdate fzf

Building fzf

See BUILD.md.

Usage

fzf will launch interactive finder, read the list from STDIN, and write the selected item to STDOUT.

find * -type f | fzf > selected

Without STDIN pipe, fzf will traverse the file system under the current directory to get the list of files.

vim $(fzf)

Note

You can override the default behavior

  • Either by setting $FZF_DEFAULT_COMMAND to a command that generates the desired list
  • Or by setting --walker, --walker-root, and --walker-skip options in $FZF_DEFAULT_OPTS

Warning

A more robust solution would be to use xargs but we've presented the above as it's easier to grasp

fzf --print0 | xargs -0 -o vim

Tip

fzf also has the ability to turn itself into a different process.

fzf --bind 'enter:become(vim {})'

See Turning into a different process for more information.

Using the finder

  • CTRL-K / CTRL-J (or CTRL-P / CTRL-N) to move cursor up and down
  • Enter key to select the item, CTRL-C / CTRL-G / ESC to exit
  • On multi-select mode (-m), TAB and Shift-TAB to mark multiple items
  • Emacs style key bindings
  • Mouse: scroll, click, double-click; shift-click and shift-scroll on multi-select mode

Display modes

fzf by default runs in fullscreen mode, but there are other display modes.

--height mode

With --height HEIGHT[%], fzf will start below the cursor with the given height.

fzf --height 40%

reverse layout and --border goes well with this option.

fzf --height 40% --layout reverse --border

By prepending ~ to the height, you're setting the maximum height.

# Will take as few lines as possible to display the list
seq 3 | fzf --height ~100%
seq 3000 | fzf --height ~100%

Height value can be a negative number.

# Screen height - 3
fzf --height -3

--tmux mode

With --tmux option, fzf will start in a tmux popup.

# --tmux [center|top|bottom|left|right][,SIZE[%]][,SIZE[%][,border-native]]

fzf --tmux center         # Center, 50% width and height
fzf --tmux 80%            # Center, 80% width and height
fzf --tmux 100%,50%       # Center, 100% width and 50% height
fzf --tmux left,40%       # Left, 40% width
fzf --tmux left,40%,90%   # Left, 40% width, 90% height
fzf --tmux top,40%        # Top, 40% height
fzf --tmux bottom,80%,40% # Bottom, 80% height, 40% height

--tmux is silently ignored when you're not on tmux.

Note

If you're stuck with an old version of tmux that doesn't support popup, or if you want to open fzf in a regular tmux pane, check out fzf-tmux script.

Tip

You can add these options to $FZF_DEFAULT_OPTS so that they're applied by default. For example,

# Open in tmux popup if on tmux, otherwise use --height mode
export FZF_DEFAULT_OPTS='--height 40% --tmux bottom,40% --layout reverse --border top'

Search syntax

Unless otherwise specified, fzf starts in "extended-search mode" where you can type in multiple search terms delimited by spaces. e.g. ^music .mp3$ sbtrkt !fire

Token Match type Description
sbtrkt fuzzy-match Items that match sbtrkt
'wild exact-match (quoted) Items that include wild
'wild' exact-boundary-match (quoted both ends) Items that include wild at word boundaries
^music prefix-exact-match Items that start with music
.mp3$ suffix-exact-match Items that end with .mp3
!fire inverse-exact-match Items that do not include fire
!^music inverse-prefix-exact-match Items that do not start with music
!.mp3$ inverse-suffix-exact-match Items that do not end with .mp3

If you don't prefer fuzzy matching and do not wish to "quote" every word, start fzf with -e or --exact option. Note that when --exact is set, '-prefix "unquotes" the term.

A single bar character term acts as an OR operator. For example, the following query matches entries that start with core and end with either go, rb, or py.

^core go$ | rb$ | py$

Environment variables

  • FZF_DEFAULT_COMMAND
    • Default command to use when input is tty
    • e.g. export FZF_DEFAULT_COMMAND='fd --type f'
  • FZF_DEFAULT_OPTS
    • Default options
    • e.g. export FZF_DEFAULT_OPTS="--layout=reverse --inline-info"
  • FZF_DEFAULT_OPTS_FILE
    • If you prefer to manage default options in a file, set this variable to point to the location of the file
    • e.g. export FZF_DEFAULT_OPTS_FILE=~/.fzfrc

Warning

FZF_DEFAULT_COMMAND is not used by shell integration due to the slight difference in requirements.

  • CTRL-T runs $FZF_CTRL_T_COMMAND to get a list of files and directories
  • ALT-C runs $FZF_ALT_C_COMMAND to get a list of directories
  • vim ~/**<tab> runs fzf_compgen_path() with the prefix (~/) as the first argument
  • cd foo**<tab> runs fzf_compgen_dir() with the prefix (foo) as the first argument

The available options are described later in this document.

Options

See the man page (man fzf) for the full list of options.

Demo

If you learn by watching videos, check out this screencast by @samoshkin to explore fzf features.

Examples

Key bindings for command-line

By setting up shell integration, you can use the following key bindings in bash, zsh, and fish.

  • CTRL-T - Paste the selected files and directories onto the command-line
    • The list is generated using --walker file,dir,follow,hidden option
      • You can override the behavior by setting FZF_CTRL_T_COMMAND to a custom command that generates the desired list
      • Or you can set --walker* options in FZF_CTRL_T_OPTS
    • Set FZF_CTRL_T_OPTS to pass additional options to fzf
      # Preview file content using bat (https://github.com/sharkdp/bat)
      export FZF_CTRL_T_OPTS="
        --walker-skip .git,node_modules,target
        --preview 'bat -n --color=always {}'
        --bind 'ctrl-/:change-preview-window(down|hidden|)'"
    • Can be disabled by setting FZF_CTRL_T_COMMAND to an empty string when sourcing the script
  • CTRL-R - Paste the selected command from history onto the command-line
    • If you want to see the commands in chronological order, press CTRL-R again which toggles sorting by relevance
    • Press CTRL-/ or ALT-/ to toggle line wrapping
    • Set FZF_CTRL_R_OPTS to pass additional options to fzf
      # CTRL-Y to copy the command into clipboard using pbcopy
      export FZF_CTRL_R_OPTS="
        --bind 'ctrl-y:execute-silent(echo -n {2..} | pbcopy)+abort'
        --color header:italic
        --header 'Press CTRL-Y to copy command into clipboard'"
  • ALT-C - cd into the selected directory
    • The list is generated using --walker dir,follow,hidden option
    • Set FZF_ALT_C_COMMAND to override the default command
      • Or you can set --walker-* options in FZF_ALT_C_OPTS
    • Set FZF_ALT_C_OPTS to pass additional options to fzf
      # Print tree structure in the preview window
      export FZF_ALT_C_OPTS="
        --walker-skip .git,node_modules,target
        --preview 'tree -C {}'"
    • Can be disabled by setting FZF_ALT_C_COMMAND to an empty string when sourcing the script

Display modes for these bindings can be separately configured via FZF_{CTRL_T,CTRL_R,ALT_C}_OPTS or globally via FZF_DEFAULT_OPTS. (e.g. FZF_CTRL_R_OPTS='--tmux bottom,60% --height 60% --border top')

More tips can be found on the wiki page.

Fuzzy completion for bash and zsh

Files and directories

Fuzzy completion for files and directories can be triggered if the word before the cursor ends with the trigger sequence, which is by default **.

  • COMMAND [DIRECTORY/][FUZZY_PATTERN]**<TAB>
# Files under the current directory
# - You can select multiple items with TAB key
vim **<TAB>

# Files under parent directory
vim ../**<TAB>

# Files under parent directory that match `fzf`
vim ../fzf**<TAB>

# Files under your home directory
vim ~/**<TAB>


# Directories under current directory (single-selection)
cd **<TAB>

# Directories under ~/github that match `fzf`
cd ~/github/fzf**<TAB>

Process IDs

Fuzzy completion for PIDs is provided for kill command.

# Can select multiple processes with <TAB> or <Shift-TAB> keys
kill -9 **<TAB>

Host names

For ssh and telnet commands, fuzzy completion for hostnames is provided. The names are extracted from /etc/hosts and ~/.ssh/config.

ssh **<TAB>
telnet **<TAB>

Environment variables / Aliases

unset **<TAB>
export **<TAB>
unalias **<TAB>

Customizing fzf options for completion

# Use ~~ as the trigger sequence instead of the default **
export FZF_COMPLETION_TRIGGER='~~'

# Options to fzf command
export FZF_COMPLETION_OPTS='--border --info=inline'

# Options for path completion (e.g. vim **<TAB>)
export FZF_COMPLETION_PATH_OPTS='--walker file,dir,follow,hidden'

# Options for directory completion (e.g. cd **<TAB>)
export FZF_COMPLETION_DIR_OPTS='--walker dir,follow'

# Advanced customization of fzf options via _fzf_comprun function
# - The first argument to the function is the name of the command.
# - You should make sure to pass the rest of the arguments ($@) to fzf.
_fzf_comprun() {
  local command=$1
  shift

  case "$command" in
    cd)           fzf --preview 'tree -C {} | head -200'   "$@" ;;
    export|unset) fzf --preview "eval 'echo \$'{}"         "$@" ;;
    ssh)          fzf --preview 'dig {}'                   "$@" ;;
    *)            fzf --preview 'bat -n --color=always {}' "$@" ;;
  esac
}

Customizing completion source for paths and directories

# Use fd (https://github.com/sharkdp/fd) for listing path candidates.
# - The first argument to the function ($1) is the base path to start traversal
# - See the source code (completion.{bash,zsh}) for the details.
_fzf_compgen_path() {
  fd --hidden --follow --exclude ".git" . "$1"
}

# Use fd to generate the list for directory completion
_fzf_compgen_dir() {
  fd --type d --hidden --follow --exclude ".git" . "$1"
}

Supported commands

On bash, fuzzy completion is enabled only for a predefined set of commands (complete | grep _fzf to see the list). But you can enable it for other commands as well by using _fzf_setup_completion helper function.

# usage: _fzf_setup_completion path|dir|var|alias|host COMMANDS...
_fzf_setup_completion path ag git kubectl
_fzf_setup_completion dir tree

Custom fuzzy completion

(Custom completion API is experimental and subject to change)

For a command named "COMMAND", define _fzf_complete_COMMAND function using _fzf_complete helper.

# Custom fuzzy completion for "doge" command
#   e.g. doge **<TAB>
_fzf_complete_doge() {
  _fzf_complete --multi --reverse --prompt="doge> " -- "$@" < <(
    echo very
    echo wow
    echo such
    echo doge
  )
}
  • The arguments before -- are the options to fzf.
  • After --, simply pass the original completion arguments unchanged ("$@").
  • Then, write a set of commands that generates the completion candidates and feed its output to the function using process substitution (< <(...)).

zsh will automatically pick up the function using the naming convention but in bash you have to manually associate the function with the command using the complete command.

[ -n "$BASH" ] && complete -F _fzf_complete_doge -o default -o bashdefault doge

If you need to post-process the output from fzf, define _fzf_complete_COMMAND_post as follows.

_fzf_complete_foo() {
  _fzf_complete --multi --reverse --header-lines=3 -- "$@" < <(
    ls -al
  )
}

_fzf_complete_foo_post() {
  awk '{print $NF}'
}

[ -n "$BASH" ] && complete -F _fzf_complete_foo -o default -o bashdefault foo

Vim plugin

See README-VIM.md.

Advanced topics

Performance

fzf is fast. Performance should not be a problem in most use cases. However, you might want to be aware of the options that can affect performance.

  • --ansi tells fzf to extract and parse ANSI color codes in the input, and it makes the initial scanning slower. So it's not recommended that you add it to your $FZF_DEFAULT_OPTS.
  • --nth makes fzf slower because it has to tokenize each line.
  • --with-nth makes fzf slower as fzf has to tokenize and reassemble each line.

Executing external programs

You can set up key bindings for starting external processes without leaving fzf (execute, execute-silent).

# Press F1 to open the file with less without leaving fzf
# Press CTRL-Y to copy the line to clipboard and aborts fzf (requires pbcopy)
fzf --bind 'f1:execute(less -f {}),ctrl-y:execute-silent(echo {} | pbcopy)+abort'

See KEY BINDINGS section of the man page for details.

Turning into a different process

become(...) is similar to execute(...)/execute-silent(...) described above, but instead of executing the command and coming back to fzf on complete, it turns fzf into a new process for the command.

fzf --bind 'enter:become(vim {})'

Compared to the seemingly equivalent command substitution vim "$(fzf)", this approach has several advantages:

  • Vim will not open an empty file when you terminate fzf with CTRL-C
  • Vim will not open an empty file when you press ENTER on an empty result
  • Can handle multiple selections even when they have whitespaces
    fzf --multi --bind 'enter:become(vim {+})'

To be fair, running fzf --print0 | xargs -0 -o vim instead of vim "$(fzf)" resolves all of the issues mentioned. Nonetheless, become(...) still offers additional benefits in different scenarios.

  • You can set up multiple bindings to handle the result in different ways without any wrapping script
    fzf --bind 'enter:become(vim {}),ctrl-e:become(emacs {})'
    • Previously, you would have to use --expect=ctrl-e and check the first line of the output of fzf
  • You can easily build the subsequent command using the field index expressions of fzf
    # Open the file in Vim and go to the line
    git grep --line-number . |
        fzf --delimiter : --nth 3.. --bind 'enter:become(vim {1} +{2})'

Reloading the candidate list

By binding reload action to a key or an event, you can make fzf dynamically reload the candidate list. See junegunn#1750 for more details.

1. Update the list of processes by pressing CTRL-R

ps -ef |
  fzf --bind 'ctrl-r:reload(ps -ef)' \
      --header 'Press CTRL-R to reload' --header-lines=1 \
      --height=50% --layout=reverse

2. Switch between sources by pressing CTRL-D or CTRL-F

FZF_DEFAULT_COMMAND='find . -type f' \
  fzf --bind 'ctrl-d:reload(find . -type d),ctrl-f:reload(eval "$FZF_DEFAULT_COMMAND")' \
      --height=50% --layout=reverse

3. Interactive ripgrep integration

The following example uses fzf as the selector interface for ripgrep. We bound reload action to change event, so every time you type on fzf, the ripgrep process will restart with the updated query string denoted by the placeholder expression {q}. Also, note that we used --disabled option so that fzf doesn't perform any secondary filtering.

: | rg_prefix='rg --column --line-number --no-heading --color=always --smart-case' \
    fzf --bind 'start:reload:$rg_prefix ""' \
        --bind 'change:reload:$rg_prefix {q} || true' \
        --bind 'enter:become(vim {1} +{2})' \
        --ansi --disabled \
        --height=50% --layout=reverse

If ripgrep doesn't find any matches, it will exit with a non-zero exit status, and fzf will warn you about it. To suppress the warning message, we added || true to the command, so that it always exits with 0.

See "Using fzf as interactive Ripgrep launcher" for more sophisticated examples.

Preview window

When the --preview option is set, fzf automatically starts an external process with the current line as the argument and shows the result in the split window. Your $SHELL is used to execute the command with $SHELL -c COMMAND. The window can be scrolled using the mouse or custom key bindings.

# {} is replaced with the single-quoted string of the focused line
fzf --preview 'cat {}'

Preview window supports ANSI colors, so you can use any program that syntax-highlights the content of a file, such as Bat or Highlight:

fzf --preview 'bat --color=always {}' --preview-window '~3'

You can customize the size, position, and border of the preview window using --preview-window option, and the foreground and background color of it with --color option. For example,

fzf --height 40% --layout reverse --info inline --border \
    --preview 'file {}' --preview-window up,1,border-horizontal \
    --bind 'ctrl-/:change-preview-window(50%|hidden|)' \
    --color 'fg:#bbccdd,fg+:#ddeeff,bg:#334455,preview-bg:#223344,border:#778899'

See the man page (man fzf) for the full list of options.

More advanced examples can be found here.

Warning

Since fzf is a general-purpose text filter rather than a file finder, it is not a good idea to add --preview option to your $FZF_DEFAULT_OPTS.

# *********************
# ** DO NOT DO THIS! **
# *********************
export FZF_DEFAULT_OPTS='--preview "bat --style=numbers --color=always --line-range :500 {}"'

# bat doesn't work with any input other than the list of files
ps -ef | fzf
seq 100 | fzf
history | fzf

Previewing an image

fzf can display images in the preview window using one of the following protocols:

See bin/fzf-preview.sh script for more information.

fzf --preview 'fzf-preview.sh {}'

Tips

Respecting .gitignore

You can use fd, ripgrep, or the silver searcher to traverse the file system while respecting .gitignore.

# Feed the output of fd into fzf
fd --type f --strip-cwd-prefix | fzf

# Setting fd as the default source for fzf
export FZF_DEFAULT_COMMAND='fd --type f --strip-cwd-prefix'

# Now fzf (w/o pipe) will use the fd command to generate the list
fzf

# To apply the command to CTRL-T as well
export FZF_CTRL_T_COMMAND="$FZF_DEFAULT_COMMAND"

If you want the command to follow symbolic links and don't want it to exclude hidden files, use the following command:

export FZF_DEFAULT_COMMAND='fd --type f --strip-cwd-prefix --hidden --follow --exclude .git'

Fish shell

CTRL-T key binding of fish, unlike those of bash and zsh, will use the last token on the command-line as the root directory for the recursive search. For instance, hitting CTRL-T at the end of the following command-line

ls /var/

will list all files and directories under /var/.

When using a custom FZF_CTRL_T_COMMAND, use the unexpanded $dir variable to make use of this feature. $dir defaults to . when the last token is not a valid directory. Example:

set -g FZF_CTRL_T_COMMAND "command find -L \$dir -type f 2> /dev/null | sed '1d; s#^\./##'"

fzf Theme Playground

fzf Theme Playground created by Vitor Mello is a webpage where you can interactively create fzf themes.

Related projects

https://github.com/junegunn/fzf/wiki/Related-projects

The MIT License (MIT)

Copyright (c) 2013-2024 Junegunn Choi

Contributors

junegunndependabot[bot]janlazoLangLangBartvovcacikcalestyojablkobitraidcharlieviethwelllekelleyma49blueyedliskina1346054relastlemueslidruckdevjustinmkakinomyoganaveensrinivasanAmbrevarlincheneystep-onee-onlyhezhizhenvifonmhinzkassiogene-pavlovskyqiemem

Issues