p0rkjello/Azure-in-bullet-points

☁️ Azure summary in bullet points

★ 0Forks 0GitHub ↗Compare

Project website ↗

README

Azure in bulletpoints

Quality checks status GitHub sponsors

  • This repo contains my study notes for different Azure exams.
  • The notes are comprehensive and written with goal of covering all exam areas.
    • I passed all of the exams with these notes.
  • Good luck & enjoy studying! ☕

Content

Support

Symbols

  • There are two symbols used throughout the documentation.

    Symbol Description
    💡 Best practice or special hint for exam
    ❗ An important limitation, challenge or an exception
    📝 Common exam area
    🤗 Fact / trivia (most likely unrelated to the exam)

AZ-900: Microsoft Azure Fundamentals

  1. Cloud Basics
    1. Benefits of Cloud Computing
    2. Cloud Deployment Models (Public vs Private vs Hybrid Cloud)
    3. Cloud Computing
      1. Compute & Serverless & Storage
      2. IaaS vs PaaS vs SaaS
    4. Cloud Compliance
    5. Scaling
  2. Azure Basics
    1. Purchasing & Licensing Options
    2. Account, Subscription, Support and Billing
    3. Azure Data Centers
    4. Interacting with Azure
    5. Service-level Agreements (SLA)
    6. Azure Resource Manager (Resources & Resource Groups & Management Groups)
    7. Compliance in Azure
  3. Azure Services
    1. Compute
      1. Virtual Machines
      2. Containers
      3. App Service
      4. Serverless Computing
    2. Storage
      1. Databases
    3. Networking
      1. Load Balancing
  4. Security
    1. Shared Responsibility Model
    2. Defence in Depth
    3. Azure Security Center
    4. Identity and Access (Azure AD)
    5. Encryption (Azure Key Vault, Certificates)
    6. Network Protection
    7. Microsoft Azure Information Protection (AIP)
    8. Microsoft Defender for Identity
    9. Microsoft Security Development Lifecycle (SDL)
  5. Governance
    1. Azure Policy & Azure Blueprints
    2. Monitoring (Azure Monitor & Azure Service Health)
  6. Economics
    1. Economies of Scale
    2. Capital Expenditure (CapEx) vs Operational Expenditure (OpEx)
    3. Azure Costs & Tools
    4. Cost Optimization Best Practices

↑

AZ-104: Microsoft Azure Administrator

  1. Management
    1. Azure Cloud Shell
    2. Resources & Costs
    3. Resource Groups
  2. Governance
    1. Roles
    2. Azure AD
      1. Entities
      2. Hybrid identities
    3. Azure Policies
  3. Monitoring
    1. Monitoring costs
  4. Storage
    1. Azure Storage
      1. Security
      2. Monitoring
    2. Azure Files
    3. Azure Backup
  5. Compute - Virtual Machines (VMs)
    1. High Availability
    2. Deployment
    3. VM Scale Sets (VMMS)
    4. Security
    5. Backups
  6. Networking
    1. Virtual Network (VNet)
      1. Connecting VNets
      2. DNS & Name Resolution
    2. Load Balancers

↑

AZ-303: Microsoft Azure Architect Technologies

  1. Azure basics
  2. Infrastructure services
    1. Monitoring
    2. Azure Storage
    3. Azure Content Delivery Network (CDN)
    4. Virtual Machines
      1. Deploy
      2. Azure Backup & Azure Site Recovery & Snapshots
    5. Virtual Networks
      1. Virtual Network Connectivity
      2. Virtual Network Interface
    6. Azure Migration
      1. Azure Migrate Service
      2. Azure Site Recovery Service
  3. Security
    1. Identities
      1. Azure Active Directory
        1. Hybrid Identities
      2. Active Directory Domain Services (ADDS)
    2. Networking
      1. Hybrid Connections (Site-to-Site VPN & ExpressRoute)
    3. Manage role-based access control (RBAC)
    4. Multi-Factor Authentication (MFA)
    5. Implement Authentication and Secure Data
      1. Authentication
      2. Authorization
      3. Encryption
  4. Application services
    1. Creating Web Applications using PaaS
    2. Web Apps (App Service)
    3. Azure Service Fabric
    4. Using containers and orchestration
    5. Serverless Computing (Azure Functions & Logic Apps)
  5. Developing for cloud
    1. Asynchronous Messaging
      1. Azure Queues (Storage Queues & Event Grid & Service Bus & Event Hubs & IoT Hub)
    2. Configure Message-based integration architecture
    3. Developing for asynchronous processes
    4. Developing for autoscaling
    5. Implement code that addresses a transient state
    6. Implement code that addresses singleton application instances
    7. Querying Azure Resources
    8. Develop database solutions
  6. Cloud architecture patterns
    1. Design and Connectivity Patterns
    2. Hybrid Networking
    3. Storing in cloud

↑

AZ-304: Microsoft Azure Architect Design

  1. Security
    1. Responsibilities
    2. Azure data centers
    3. Azure Key Vault
    4. Azure Active Directory (Azure AD)
  2. SaaS services in Azure
    1. Cognitive Services
    2. Bots (Bot Services, QnA Maker)
    3. Azure Machine Learning
    4. Media Processing
  3. Data platform
    1. Storage
      1. Azure Storage
        1. Storage Account
      2. StorSimple
    2. SQL (Azure SQL Database)
    3. Big data services
    4. Azure Automation
    5. Data Analysis (Azure Analysis Services, HDInsight, Azure Data Catalog)
    6. Backup (Azure Backup & Azure Site Recovery)
    7. Monitoring
      1. Azure Sentinel
  4. Deployment, Migration and Integration
    1. Azure Resource Manager
      1. Role-Based Access Control (RBAC)
      2. Azure Resource Policies
      3. Securing ARM templates
      4. Deploying ARM templates (Azure Building Blocks)
    2. Managed Server Applications (App Service Environments, Azure Service Fabric, Azure Container Service, Azure Container Instance)
      1. High-Performance Compute (HPC)
    3. Migration strategies
    4. App Services
    5. Authoring Serverless Applications in Azure
  5. Infrastructure strategy
    1. Application Architecture Patterns in Azure
    2. VM Availability (SLA, Availability Sets, Availability Zones)
    3. Azure VM Scale Sets
    4. Hybrid Cloud
    5. Networking Azure Application Components
    6. Messaging Services

↑

AZ-400: Designing and Implementing Microsoft DevOps Solutions

  1. Introduction
    1. Design a DevOps Strategy
    2. Common tools for DevOps
  2. Azure DevOps Overview
    1. Migrations
  3. Agile work management
    1. Azure Boards
  4. Continuous Testing
    1. Choosing Test and Work Management Tools
    2. Azure Test Plans
  5. Continuous Feedback
    1. Azure Monitor
  6. Package management
    1. Azure Artifacts
  7. Continuous Integration & Continuous Delivery
    1. Deployment Patterns
    2. Azure Pipelines
      1. Container Agents
      2. Release Pipelines
      3. DevTest Labs
    3. Jenkins
    4. SonarQube
  8. DevSecOps
    1. Azure Key Vault
  9. Source code version control
    1. Git
    2. Pull request strategies
    3. Azure Repos
  10. Containers
    1. Azure Container Registry
    2. Azure Kubernetes Service
  11. Mobile DevOps (Visual Studio App Center)
  12. Infrastructure as code
    1. ARM templates
  13. Configuration as Code (PowerShell DSC & Azure Automation & Custom Script)

↑

Contributors

undergroundwiresSauravDas90Max-MZatulkaushalnetsyderdipankar2308GlennChiajameswyldekeenan-npanchalmanish2208saschagottfriedben12385jasonotumyoriginalusernamertilwaliatalshafievkuss

Issues